Anti-DPD antibody (ab180609)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-DPD antibody
See all DPD primary antibodies -
Description
Rabbit polyclonal to DPD -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Recombinant full length protein corresponding to Human DPD aa 1-173.
Sequence:MAPVLSKDSADIESILALNPRTQTHATLCSTSAKKLDKKHWKRNPDKNCF NCEKLENNFDDIKHTTLGERGALREAMRCLKCADAPCQKSCPTNLDIKSF ITSIANKNYYGAAKMIFSDNPLGLTCGMVCPTSDLCVGGCNLYATEEGPI NIGGLQQFATETLILAFSLMNHL
Database link: Q12882-2 -
Positive control
- THP-1 and HeLa cell extracts.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab180609 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/50 - 1/200. ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody. |
|
| WB | 1/500 - 1/2000. Predicted molecular weight: 19, 111 kDa. |
Target
-
Function
Involved in pyrimidine base degradation. Catalyzes the reduction of uracil and thymine. Also involved the degradation of the chemotherapeutic drug 5-fluorouracil. -
Tissue specificity
Found in most tissues with greatest activity found in liver and peripheral blood mononuclear cells. -
Pathway
Amino-acid biosynthesis; beta-alanine biosynthesis. -
Involvement in disease
Defects in DPYD are the cause of dihydropyrimidine dehydrogenase deficiency (DPYD deficiency) [MIM:274270]; also known as hereditary thymine-uraciluria or familial pyrimidinemia. DPYD deficiency is a disease characterized by persistent urinary excretion of excessive amounts of uracil, thymine and 5-hydroxymethyluracil. Patients suffering from this disease show a severe reaction to the anticancer drug 5-fluorouracil. This reaction includes stomatitis, Leukopenia, thrombocytopenia, hair loss, diarrhea, fever, marked weight loss, cerebellar ataxia, and neurologic symptoms, progressing to semicoma. -
Sequence similarities
Belongs to the dihydropyrimidine dehydrogenase family.
Contains 3 4Fe-4S ferredoxin-type domains. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 1806 Human
- Entrez Gene: 99586 Mouse
- Entrez Gene: 81656 Rat
- GenBank: AAH08379 Human
- Omim: 274270 Human
- Omim: 612779 Human
- SwissProt: Q12882 Human
- SwissProt: Q8CHR6 Mouse
see all -
Alternative names
- DHP antibody
- DHPDHase antibody
- Dihydropyrimidine dehydrogenase [NADP(+)] antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DPD antibody (ab180609)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of mouse lung tissue labelling DPD with ab180609 at 1/100. Magnification: 200x.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DPD antibody (ab180609)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human stomach cancer tissue labelling DPD with ab180609 at 1/100. Magnification: 200x.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DPD antibody (ab180609)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human lung cancer tissue labelling DPD with ab180609 at 1/100. Magnification: 200x.
-
Western blot - Anti-DPD antibody (ab180609)All lanes : Anti-DPD antibody (ab180609) at 1/500 dilution
Lane 1 : THP-1 cell extract
Lane 2 : HeLa cell extract
Predicted band size: 19, 111 kDa
Datasheets and documents
References
ab180609 has not yet been referenced specifically in any publications.
