Overview

  • Product name

  • Description

    Rabbit polyclonal to DPM1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow, Pig
  • Immunogen

    Recombinant full length protein corresponding to Human DPM1 aa 2-260.
    Sequence:

    ASLEVSRSPRRSRRELEVRSPRQNKYSVLLPTYNERENLPLIVWLLVKSF SESGINYEIIIIDDGSPDGTRDVAEQLEKIYGSDRILLRPREKKLGLGTA YIHGMKHATGNYIIIMDADLSHHPKFIPEFIRKQKEGNFDIVSGTRYKGN GGVYGWDLKRKIISRGANFLTQILLRPGASDLTGSFRLYRKEVLEKLIEK CVSKGYVFQMEMIVRARQLNYTIGEVPISFVDRVYGESKLGGNEIVSFLK GLLTLFATT


    Database link: O60762

  • Positive control

    • WB: Mouse lung lysate. IHC-P: Human kidney and pancreas tissue. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236604 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Predicted molecular weight: 30 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Transfers mannose from GDP-mannose to dolichol monophosphate to form dolichol phosphate mannose (Dol-P-Man) which is the mannosyl donor in pathways leading to N-glycosylation, glycosyl phosphatidylinositol membrane anchoring, and O-mannosylation of proteins.
  • Pathway

    Protein modification; protein glycosylation.
  • Involvement in disease

    Defects in DPM1 are the cause of congenital disorder of glycosylation type 1E (CDG1E) [MIM:608799]. CDGs are metabolic deficiencies in glycoprotein biosynthesis that usually cause severe mental and psychomotor retardation. They are characterized by under-glycosylated serum glycoproteins. CDG1E is an autosomal recessive disorder, characterized by severe developmental delay, hypotnia, seizures, and dysmorphic features.
  • Sequence similarities

    Belongs to the glycosyltransferase 2 family.
  • Cellular localization

    Endoplasmic reticulum.
  • Information by UniProt
  • Database links

  • Alternative names

    • CDGIE antibody
    • dolichol monophosphate mannose synthase antibody
    • Dolichol phosphate mannose synthase antibody
    • Dolichol-phosphate mannose synthase antibody
    • Dolichol-phosphate mannosyltransferase antibody
    • Dolichyl phosphate beta D mannosyltransferase antibody
    • dolichyl phosphate mannosyltransferase polypeptide 1 antibody
    • dolichyl phosphate mannosyltransferase polypeptide 1 catalytic subunit antibody
    • Dolichyl-phosphate beta-D-mannosyltransferase antibody
    • DPM synthase antibody
    • DPM1 antibody
    • DPM1_HUMAN antibody
    • Mannose P dolichol synthase antibody
    • Mannose-P-dolichol synthase antibody
    • MPD synthase antibody
    • MPDS antibody
    see all

Images

  • Anti-DPM1 antibody (ab236604) at 1/500 dilution + Mouse lung lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 30 kDa

  • Paraffin-embedded human kidney tissue stained for DPM1 using ab236604 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreas tissue stained for DPM1 using ab236604 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for DPM1 (green) using ab236604 at 1/100 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236604 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236604.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up