Overview

  • Product name

  • Description

    Rabbit polyclonal to DPP6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human, Pig
    Predicted to work with: Mouse, Cow, Chimpanzee
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human DPP6 aa 667-865. (Expressed in E.coli).
    Sequence:

    FQGTKLLHEVRRRLGLLEEKDQMEAVRTMLKEQYIDRTRVAVFGKDYGGY LSTYILPAKGENQGQTFTCGSALSPITDFKLYASAFSERYLGLHGLDNRA YEMTKVAHRVSALEEQQFLIIHPTADEKIHFQHTAELITQLIRGKANYSL QIYPDESHYFTSSSLKQHLYRSIINFFVECFRIQDKLLTVTAKEDEEED


    Database link: P42658

  • Positive control

    • WB: Rat and pig cerebrum lysates; Recombinant human DPP6 protein. IHC-P: Human brain tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232722 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 98 kDa.

Target

  • Relevance

    DPP6 (DPPX, also known as potassium channel accelerating factor Dppx) is a Type-II serine proteinase of the clan SC. The clan SC proteinases have a catalytic triad of Ser-Asp-His, and like other Serine proteinases, the active site serine is in a Gly-Xaa-Ser-Xaa -Gly orientation. DPP6 has an Asp instead of Ser in the catalytic site. DPP6 is a member of a broader family of dipeptidyl peptidases including DPP4, FAP/Seprase, DPP2, DPP8, DPP9, DPP10, which have differing substrate specificity and tissue localizations. The surface-bound DPP6 is a homodimer, and cleavage of in the stalk region releases a shed form of DPP6. The shed is the form found in serum. DPP6 has been found in highest abundance in the brain, but also in the kidney, liver and lung.
  • Cellular localization

    Cell Membrane; single-pass type II membrane protein
  • Database links

  • Alternative names

    • Dipeptidyl aminopeptidase IV related protein antibody
    • Dipeptidyl aminopeptidase like protein 6 antibody
    • Dipeptidyl aminopeptidase related protein antibody
    • Dipeptidyl peptidase 6 antibody
    • Dipeptidyl peptidase IV like protein antibody
    • Dipeptidyl peptidase IV related protein antibody
    • Dipeptidylpeptidase 6 antibody
    • Dipeptidylpeptidase VI antibody
    • DPP VI antibody
    • DPPX antibody
    • VF2 antibody
    see all

Images

  • Anti-DPP6 antibody (ab232722) at 2 µg/ml + Pig cerebrum lysate

    Predicted band size: 98 kDa

  • Anti-DPP6 antibody (ab232722) at 2 µg/ml + Rat cerebrum lysate

    Predicted band size: 98 kDa

  • Anti-DPP6 antibody (ab232722) at 2 µg/ml + Recombinant human DPP6 protein

    Predicted band size: 98 kDa

  • Formalin-fixed, paraffin-embedded human brain tissue stained for DPP6 using ab232722 at 20 µg/mL in immunohistochemical analysis. DAB staining.

References

ab232722 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232722.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up