Anti-Dppa5 antibody (ab236611)
Key features and details
- Rabbit polyclonal to Dppa5
- Suitable for: IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Dppa5 antibody -
Description
Rabbit polyclonal to Dppa5 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human Dppa5 aa 1-116.
Sequence:MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV SKAMLELKALESSDLTEVVVYGSYLYKLRTKWMLQSMAEWHRQRQERGML KLAEAMNALELGPWMK
Database link: A6NC42 -
Positive control
- IHC-P: Human liver cancer and ovarian cancer tissue. ICC/IF: HepG2 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: PBS, 50% Glycerol (glycerin, glycerine), 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab236611 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/200 - 1/500. | |
ICC/IF | 1/50 - 1/200. |
Target
-
Function
Involved in the maintenance of embryonic stem (ES) cell pluripotency. Dispensable for self-renewal of pluripotent ES cells and establishment of germ cells. Associates with specific target mRNAs. -
Sequence similarities
Belongs to the KHDC1 family.
Contains 1 KH domain. -
Developmental stage
Expressed in primordial germ (PGC), embryonic germ (EGC) and embryonic stem (ESC) cells. Not detected in embryonic carcinoma (ECC) cells. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 340168 Human
- Omim: 611111 Human
- SwissProt: A6NC42 Human
- Unigene: 125331 Human
-
Alternative names
- Developmental pluripotency associated 5 antibody
- Developmental pluripotency-associated 5 protein antibody
- DPPA5 antibody
see all
Images
-
HepG2 (human liver hepatocellular carcinoma cell line) cells stained for Dppa5 using ab236611 at a dilution of 1/66 in ICC/IF.
The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the primary antibody overnight at 4°C. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L). -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Dppa5 antibody (ab236611)
Paraffin-embedded human liver cancer tissue stained for Dppa5 using ab236611 at 1/200 dilution in immunohistochemical analysis.
After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Dppa5 antibody (ab236611)
Paraffin-embedded human ovarian cancer tissue stained for Dppa5 using ab236611 at 1/200 dilution in immunohistochemical analysis.
After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab236611 has not yet been referenced specifically in any publications.