Overview

  • Product name

  • Description

    Rabbit polyclonal to DPT/TRAMP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow, Pig
  • Immunogen

    Recombinant fragment corresponding to Human DPT/TRAMP aa 19-201.
    Sequence:

    QYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEG SDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSR YFESVLDREWQFYCCRYSKRCPYSCWLTTEYPGHYGEEMDMISYNYDYYI RGATTTFSAVERDRQWKFIMCRMTEYDCEFANV


    Database link: Q07507

  • Positive control

    • IHC-P: Human pancreatic cancer tissue and brain tissue.
  • General notes

     This product was previously labelled as Dermatopontin

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230195 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Seems to mediate adhesion by cell surface integrin binding. May serve as a communication link between the dermal fibroblast cell surface and its extracellular matrix environment. Enhances TGFB1 activity. Inhibits cell proliferation. Accelerates collagen fibril formation, and stabilizes collagen fibrils against low-temperature dissociation.
  • Tissue specificity

    Expressed in fibroblasts, heart, skeletal muscle, brain and pancreas. Expressed at an intermediate level in lung and kidney, and at a low level in liver and placenta. Expressed at a lower level in fibroblasts from hypertrophic scar lesional skin and in fibroblasts from patients with systemic sclerosis than in normal skin fibroblasts.
  • Sequence similarities

    Belongs to the dermatopontin family.
  • Post-translational
    modifications

    Sulfated on tyrosine residue(s).
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • DERM_HUMAN antibody
    • Dermatopontin antibody
    • Dpt antibody
    • TRAMP antibody
    • Tyrosine rich acidic matrix protein antibody
    • Tyrosine-rich acidic matrix protein antibody
    see all

Images

  • Paraffin-embedded human brain tissue stained for DPT/TRAMP using ab230195 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreatic tissue stained for DPT/TRAMP using ab230195 at 1/100 dilution in immunohistochemical analysis.

References

ab230195 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230195.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up