Anti-DPT/TRAMP antibody (ab230195)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-DPT/TRAMP antibody
See all DPT/TRAMP primary antibodies -
Description
Rabbit polyclonal to DPT/TRAMP -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Cow, Pig -
Immunogen
Recombinant fragment corresponding to Human DPT/TRAMP aa 19-201.
Sequence:QYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEG SDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSR YFESVLDREWQFYCCRYSKRCPYSCWLTTEYPGHYGEEMDMISYNYDYYI RGATTTFSAVERDRQWKFIMCRMTEYDCEFANV
Database link: Q07507 -
Positive control
- IHC-P: Human pancreatic cancer tissue and brain tissue.
-
General notes
This product was previously labelled as Dermatopontin
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.3
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab230195 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/20 - 1/200. |
Target
-
Function
Seems to mediate adhesion by cell surface integrin binding. May serve as a communication link between the dermal fibroblast cell surface and its extracellular matrix environment. Enhances TGFB1 activity. Inhibits cell proliferation. Accelerates collagen fibril formation, and stabilizes collagen fibrils against low-temperature dissociation. -
Tissue specificity
Expressed in fibroblasts, heart, skeletal muscle, brain and pancreas. Expressed at an intermediate level in lung and kidney, and at a low level in liver and placenta. Expressed at a lower level in fibroblasts from hypertrophic scar lesional skin and in fibroblasts from patients with systemic sclerosis than in normal skin fibroblasts. -
Sequence similarities
Belongs to the dermatopontin family. -
Post-translational
modificationsSulfated on tyrosine residue(s). -
Cellular localization
Secreted > extracellular space > extracellular matrix. - Information by UniProt
-
Database links
- Entrez Gene: 1805 Human
- Entrez Gene: 56429 Mouse
- Omim: 125597 Human
- SwissProt: Q07507 Human
- SwissProt: Q9QZZ6 Mouse
- Unigene: 80552 Human
- Unigene: 28935 Mouse
-
Alternative names
- DERM_HUMAN antibody
- Dermatopontin antibody
- Dpt antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DPT/TRAMP antibody (ab230195)
Paraffin-embedded human brain tissue stained for DPT/TRAMP using ab230195 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DPT/TRAMP antibody (ab230195)
Paraffin-embedded human pancreatic tissue stained for DPT/TRAMP using ab230195 at 1/100 dilution in immunohistochemical analysis.
Datasheets and documents
References
ab230195 has not yet been referenced specifically in any publications.