Anti-DPT/TRAMP antibody (ab230195)

Submit a review Submit a question

Key features and details

  • Rabbit polyclonal to DPT/TRAMP
  • Suitable for: IHC-P
  • Reacts with: Human
  • Isotype: IgG

Overview

  • Product name

    Anti-DPT/TRAMP antibody
    See all DPT/TRAMP primary antibodies

  • Description

    Rabbit polyclonal to DPT/TRAMP

  • Host species

    Rabbit

  • Tested applications

    Suitable for: IHC-Pmore details

  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow, Pig

  • Immunogen

    Recombinant fragment corresponding to Human DPT/TRAMP aa 19-201.
    Sequence:

    QYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEG SDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSR YFESVLDREWQFYCCRYSKRCPYSCWLTTEYPGHYGEEMDMISYNYDYYI RGATTTFSAVERDRQWKFIMCRMTEYDCEFANV


    Database link: Q07507

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • IHC-P: Human pancreatic cancer tissue and brain tissue.

  • General notes

     This product was previously labelled as Dermatopontin

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid

  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol (glycerin, glycerine)
  • Concentration information loading...

  • Purity

    Immunogen affinity purified

  • Clonality

    Polyclonal

  • Isotype

    IgG

  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230195 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Seems to mediate adhesion by cell surface integrin binding. May serve as a communication link between the dermal fibroblast cell surface and its extracellular matrix environment. Enhances TGFB1 activity. Inhibits cell proliferation. Accelerates collagen fibril formation, and stabilizes collagen fibrils against low-temperature dissociation.

  • Tissue specificity

    Expressed in fibroblasts, heart, skeletal muscle, brain and pancreas. Expressed at an intermediate level in lung and kidney, and at a low level in liver and placenta. Expressed at a lower level in fibroblasts from hypertrophic scar lesional skin and in fibroblasts from patients with systemic sclerosis than in normal skin fibroblasts.

  • Sequence similarities

    Belongs to the dermatopontin family.

  • Post-translational
    modifications

    Sulfated on tyrosine residue(s).

  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

  • Database links

    • Alternative names

      • DERM_HUMAN antibody
      • Dermatopontin antibody
      • Dpt antibody
      • TRAMP antibody
      • Tyrosine rich acidic matrix protein antibody
      • Tyrosine-rich acidic matrix protein antibody
      see all

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DPT/TRAMP antibody (ab230195)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DPT/TRAMP antibody (ab230195)

      Paraffin-embedded human brain tissue stained for DPT/TRAMP using ab230195 at 1/100 dilution in immunohistochemical analysis.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DPT/TRAMP antibody (ab230195)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DPT/TRAMP antibody (ab230195)

      Paraffin-embedded human pancreatic tissue stained for DPT/TRAMP using ab230195 at 1/100 dilution in immunohistochemical analysis.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    References (0)

    Publishing research using ab230195? Please let us know so that we can cite the reference in this datasheet.

    ab230195 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab230195.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com