Overview

  • Product name

    Anti-DPY30 antibody - N-terminal
    See all DPY30 primary antibodies
  • Description

    Rabbit polyclonal to DPY30 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IPmore details
    Unsuitable for: WB
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Cow, Dog, Pig, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Chinese hamster, Orangutan
  • Immunogen

    Synthetic peptide within Human DPY30 aa 1-50 (N terminal). The exact sequence is proprietary. NP_115963.1.
    Sequence:

    MEPEQMLEGQTQVAENPHSEYGLTDNVERIVENEKINAEKSSKQKVDLQS


    Database link: Q9C005

  • Positive control

    • 293T whole cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab187690 was affinity purified using an epitope specific to DPY30 immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab187690 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
  • Application notes
    Is unsuitable for WB.
  • Target

    Images

    • Detection of DPY30 by Western Blot of Immunoprecipitate.
      ab187690 at 1µg/ml labeling DPY30 in 293T whole cell lysate immunoprecipitated using ab187690 at 6µg/mg lysate (1 mg/IP; 20% of IP loaded/lane). Detection: Chemiluminescence with exposure time of 3 minutes.

      Please note: ab187690 has not performed satisfactorily when used for WB of DPY30 in crude preparations (e.g. whole cell lysate). It can be used for WB of enriched DPY30 (e.g. immunoprecipitated).

       

       

    References

    ab187690 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab187690.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up