Overview

  • Product name

  • Description

    Rabbit polyclonal to DPYS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DPYS aa 440-512.
    Sequence:

    TISRGKVVYEAGVFSVTAGDGKFIPRKPFAEYIYKRIKQRDRTCTPTPVE RAPYKGEVATLKSRVTKEDATAG

  • Positive control

    • Human kidney tissue; DPYS over-expression HEK293T lysate.
  • General notes

    Previously labelled as Dihydropyrimidinase.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab121844 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Recommend PFA Fixation and Triton X-100 treatment

IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/250 - 1/500.

Target

  • Function

    Catalyzes the second step of the reductive pyrimidine degradation, the reversible hydrolytic ring opening of dihydropyrimidines. Can catalyzes the ring opening of 5,6-dihydrouracil to N-carbamyl-alanine and of 5,6-dihydrothymine to N-carbamyl-amino isobutyrate.
  • Tissue specificity

    Liver and kidney.
  • Involvement in disease

    Defects in DPYS are the cause of dihydropyrimidinase deficiency (DHPD) [MIM:222748]. DHPD is an autosomal recessive disorder characterized by dihydropyrimidinuria and associated with a variable clinical phenotype: epileptic or convulsive attacks, dysmorphic features and severe developmental delay, and congenital microvillous atrophy.
  • Sequence similarities

    Belongs to the DHOase family. Hydantoinase/dihydropyrimidinase subfamily.
  • Post-translational
    modifications

    Carbamylation allows a single lysine to coordinate two zinc ions.
  • Information by UniProt
  • Database links

  • Alternative names

    • DHP antibody
    • DHPase antibody
    • Dihydropyrimidinase antibody
    • Dihydropyrimidine amidohydrolase antibody
    • Dpys antibody
    • DPYS_HUMAN antibody
    • Hydantoinase antibody
    see all

Images

  • All lanes : Anti-DPYS antibody (ab121844) at 1/250 dilution

    Lane 1 : Negative control (vector only transfected HEK293T lysate)

    Lane 2 : Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells

    Developed using the ECL technique.
  • Immunofluorescent staining of Human cell line A-431 shows positivity in vesicles and centrosome. Recommended concentration of ab121844 1-4 µg/ml. Cells treated with PFA/Triton X-100.
  • ab121844 at 1/500 dilution staining DPYS in Paraffin-embedded Human kidney tissue by Immunohistochemistry.

References

ab121844 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab121844.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up