Overview

  • Product name

  • Description

    Rabbit polyclonal to DPYS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human DPYS aa 1-519.
    Sequence:

    MAAPSRLLIRGGRVVNDDFSEVADVLVEDGVVRALGHDLLPPGGAPAGLR VLDAAGKLVLPGGIDTHTHMQFPFMGSRSIDDFHQGTKAALSGGTTMIID FAIPQKGGSLIEAFETWRSWADPKVCCDYSLHVAVTWWSDQVKEEMKILV QDKGVNSFKMFMAYKDLYMVTDLELYEAFSRCKEIGAIAQVHAENGDLIA EGAKKMLALGITGPEGHELCRPEAVEAEATLRAITIASAVNCPLYIVHVM SKSAAKVIADARRDGKVVYGEPIAASLGTDGTHYWNKEWHHAAHHVMGPP LRPDPSTPDFLMNLLANDDLTTTGTDNCTFNTCQKALGKDDFTKIPNGVN GVEDRMSVIWEKGVHSGKMDENRFVAVTSTNAAKIFNLYPRKGRIAVGSD ADIVIWDPKGTRTISAKTHHQAVNFNIFEGMVCHGVPLVTISRGKVVYEA GVFSVTAGDGKFIPRKPFAEYIYKRIKQRDRTCTPTPVERAPYKGEVATL KSRVTKEDATAGTRKQAHP


    Database link: Q14117

  • Positive control

    • 293T, mouse liver, mouse kidney, mouse brain and rat kidney cell lysates.
  • General notes

    Previously labelled as Dihydropyrimidinase.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab202126 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 56 kDa.

Target

  • Function

    Catalyzes the second step of the reductive pyrimidine degradation, the reversible hydrolytic ring opening of dihydropyrimidines. Can catalyzes the ring opening of 5,6-dihydrouracil to N-carbamyl-alanine and of 5,6-dihydrothymine to N-carbamyl-amino isobutyrate.
  • Tissue specificity

    Liver and kidney.
  • Involvement in disease

    Defects in DPYS are the cause of dihydropyrimidinase deficiency (DHPD) [MIM:222748]. DHPD is an autosomal recessive disorder characterized by dihydropyrimidinuria and associated with a variable clinical phenotype: epileptic or convulsive attacks, dysmorphic features and severe developmental delay, and congenital microvillous atrophy.
  • Sequence similarities

    Belongs to the DHOase family. Hydantoinase/dihydropyrimidinase subfamily.
  • Post-translational
    modifications

    Carbamylation allows a single lysine to coordinate two zinc ions.
  • Information by UniProt
  • Database links

  • Alternative names

    • DHP antibody
    • DHPase antibody
    • Dihydropyrimidinase antibody
    • Dihydropyrimidine amidohydrolase antibody
    • Dpys antibody
    • DPYS_HUMAN antibody
    • Hydantoinase antibody
    see all

Images

  • All lanes : Anti-DPYS antibody (ab202126) at 1/500 dilution

    Lane 1 : 293T cell lysate
    Lane 2 : Mouse liver cell lysate
    Lane 3 : Mouse kidney cell lysate
    Lane 4 : Mouse brain cell lysate
    Lane 5 : Rat kidney cell lysate

    Predicted band size: 56 kDa

References

ab202126 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202126.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up