Overview

  • Product name

  • Description

    Rabbit polyclonal to DR3/LARD
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Human DR3/LARD aa 370-417 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    RFRDQQYEMLKRWRQQQPAGLGAVYAALERMGLDGCVEDLRSRLQRGP


    Database link: Q93038

  • Positive control

    • Human colon carcinoma lysate; Human colon tissue.
  • General notes

     This product was previously labelled as DR3

     

Properties

Applications

Our Abpromise guarantee covers the use of ab216658 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/100 - 1/1000. Detects a band of approximately 43 kDa (predicted molecular weight: 45 kDa).

Target

  • Function

    Receptor for TNFSF12/APO3L/TWEAK. Interacts directly with the adapter TRADD. Mediates activation of NF-kappa-B and induces apoptosis. May play a role in regulating lymphocyte homeostasis.
  • Tissue specificity

    Abundantly expressed in thymocytes and lymphocytes. Detected in lymphocyte-rich tissues such as thymus, colon, intestine, and spleen. Also found in the prostate.
  • Sequence similarities

    Contains 1 death domain.
    Contains 4 TNFR-Cys repeats.
  • Post-translational
    modifications

    Glycosylated.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Apo 3 antibody
    • Apo-3 antibody
    • Apo3 antibody
    • Apoptosis inducing receptor AIR antibody
    • Apoptosis inducing receptor antibody
    • Apoptosis mediating receptor antibody
    • Apoptosis mediating receptor DR 3 antibody
    • Apoptosis mediating receptor DR3 antibody
    • Apoptosis mediating receptor TRAMP antibody
    • Apoptosis-inducing receptor AIR antibody
    • Apoptosis-mediating receptor DR3 antibody
    • Apoptosis-mediating receptor TRAMP antibody
    • DDR 3 antibody
    • DDR3 antibody
    • Death domain receptor 3 antibody
    • Death domain receptor 3 soluble form antibody
    • Death receptor 3 antibody
    • Death receptor beta antibody
    • DR 3 antibody
    • DR3 antibody
    • LARD antibody
    • Lymphocyte associated receptor of death antibody
    • Lymphocyte-associated receptor of death antibody
    • Protein WSL antibody
    • Protein WSL-1 antibody
    • TNF receptor superfamily member 25 antibody
    • TNFR25 antibody
    • TNFRSF 12 antibody
    • TNFRSF 25 antibody
    • TNFRSF12 antibody
    • TNFRSF12, formerly antibody
    • TNFRSF25 antibody
    • TNR25_HUMAN antibody
    • TR 3 antibody
    • TR3 antibody
    • TRAMP antibody
    • Translocating chain association membrane protein antibody
    • Tumor necrosis factor receptor superfamily member 12 antibody
    • Tumor necrosis factor receptor superfamily member 25 antibody
    • Tumor necrosis factor receptor superfamily, member 12 (translocating chain association membrane protein) antibody
    • Tumor necrosis factor receptor superfamily, member 12, formerly antibody
    • WSL 1 antibody
    • WSL antibody
    • WSL LR antibody
    • WSL protein antibody
    • WSL1 antibody
    • WSL1 protein antibody
    • WSLLR antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human colon tissue labeling DR3/LARD with ab216658 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • All lanes : Anti-DR3/LARD antibody (ab216658) at 1/200 dilution

    Lane 1 : Human colon carcinoma lysate
    Lane 2 : Rat brain lysate

    Secondary
    All lanes : Goat anti-rabbit IgG (H+L), HRP conjugated at 1/3000 dilution

    Predicted band size: 45 kDa
    Observed band size: 43 kDa
    why is the actual band size different from the predicted?



    12% gel

References

ab216658 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216658.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up