Overview

  • Product name

    Anti-DR4 antibody [OTI8A12]
    See all DR4 primary antibodies
  • Description

    Mouse monoclonal [OTI8A12] to DR4
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DR4 aa 263-468. (NP_003835) produced in E.coli.
    Sequence:

    CIGSGCGGDPKCMDRVCFWRLGLLRGPGAEDNAHNEILSNADSLSTFVSE QQMESQEPADLTGVTVQSPGEAQCLLGPAEAEGSQRRRLLVPANGADPTE TLMLFFDKANIVPFDSWDQLMRQLDLTKNEIDVVRAGTAGPGDALYAMLM KWVNKTGRNASIHTLLDALERMEERHAREKIQDLLVDSGKFIYLEDGTGS AVSLE


    Database link: O00220

  • Positive control

    • WB: pCMV6-ENTRY DR4 cDNA transfected HEK-293T cell lysate; K562 cell lysate and human uterus tissue lysate.
  • General notes

    Clone OTI8A12 (formerly 8A12).

Properties

Applications

Our Abpromise guarantee covers the use of ab236522 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/2000. Predicted molecular weight: 50 kDa.

Target

  • Function

    Receptor for the cytotoxic ligand TNFSF10/TRAIL. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappa-B.
  • Tissue specificity

    Widely expressed. High levels are found in spleen, peripheral blood leukocytes, small intestine and thymus, but also in K562 erythroleukemia cells, MCF7 breast carcinoma cells and activated T-cells.
  • Sequence similarities

    Contains 1 death domain.
    Contains 3 TNFR-Cys repeats.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Apo2 antibody
    • CD261 antibody
    • Cytotoxic TRAIL receptor antibody
    • Death receptor 4 antibody
    • DR4 antibody
    • NF related apoptosis-inducing ligand receptor 1 antibody
    • TNF receptor superfamily member 10a antibody
    • TNF-related apoptosis-inducing ligand receptor 1 antibody
    • TNFRSF10A antibody
    • TR10A_HUMAN antibody
    • TRAIL receptor 1 antibody
    • TRAIL-R1 antibody
    • TRAILR 1 antibody
    • TRAILR1 antibody
    • Tumor necrosis factor receptor superfamily member 10A antibody
    • Tumor necrosis factor receptor superfamily member 10a variant 2 antibody
    • Tumor necrosis factor receptor superfamily, member 10a antibody
    see all

Images

  • All lanes : Anti-DR4 antibody [OTI8A12] (ab236522) at 1/2000 dilution

    Lane 1 : K562 (Human chronic myelogenous leukemia cell line from bone marrow) cell lysate
    Lane 2 : Human uterus lysate

    Lysates/proteins at 10 µg per lane.

    Predicted band size: 50 kDa

  • All lanes : Anti-DR4 antibody [OTI8A12] (ab236522) at 1/2000 dilution

    Lane 1 : pCMV6-ENTRY control cDNA transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : pCMV6-ENTRY DR4 cDNA transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 50 kDa

References

ab236522 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236522.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up