Overview

  • Product name

  • Description

    Rabbit polyclonal to DR6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: Flow Cytmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human DR6 aa 140-170 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    SNATCAPHTVCPVGWGVRKKGTETEDVRCKQ


    Database link: O75509

  • Positive control

    • H9C2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 1% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab214466 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt 1/20 - 1/100.

Target

  • Function

    May activate NF-kappa-B and promote apoptosis. May activate JNK and be involved in T-cell differentiation. Required for both normal cell body death and axonal pruning. Trophic-factor deprivation triggers the cleavage of surface APP by beta-secretase to release sAPP-beta which is further cleaved to release an N-terminal fragment of APP (N-APP). N-APP binds TNFRSF21 triggering caspase activation and degeneration of both neuronal cell bodies (via caspase-3) and axons (via caspase-6).
  • Tissue specificity

    Highly expressed in heart, brain, placenta, pancreas, lymph node, thymus and prostate. Detected at lower levels in lung, skeletal muscle, kidney, testis, uterus, small intestine, colon, spleen, bone marrow and fetal liver. Very low levels were found in adult liver and peripheral blood leukocytes.
  • Sequence similarities

    Contains 1 death domain.
    Contains 4 TNFR-Cys repeats.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • TNFRSF 21 antibody
    • BM 018 antibody
    • BM018 antibody
    • CD358 antibody
    • Death receptor 6 antibody
    • DR 6 antibody
    • DR6 antibody
    • MGC31965 antibody
    • OTTHUMP00000039915 antibody
    • TNFR related death receptor 6 antibody
    • TNFRSF21 antibody
    • TNFRSF21 protein antibody
    • TNR21_HUMAN antibody
    • Tumor necrosis factor receptor superfamily member 21 antibody
    • Tumor necrosis factor receptor superfamily member 21 precursor antibody
    see all

Images

  • Flow cytometrical analysis of H9C2 cells labeling DR6 with ab214466 at 1/100 dilution followed by incubation with a FITC-conjugated secondary (green) for 30 minutes compared to control cells (blue), secondary only (light blue) and isotype control (orange).

References

ab214466 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214466.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up