Overview

  • Product name

  • Description

    Rabbit polyclonal to DRAM2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human DRAM2 aa 182-266.
    Sequence:

    SGNFGTDLEQKLHWNPEDKGYVLHMITTAAEWSMSFSFFGFFLTYIRDFQ KISLRVEANLHGLTLYDTAPCPINNERTRLLSRDI


    Database link: Q6UX65

  • Positive control

    • WB: Mouse heart and liver tissue lysates. IHC-P: Human bladder cancer and heart tissue. ICC/IF: MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab230191 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 30 kDa (predicted molecular weight: 30 kDa).
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Induces apoptotic cell death when co-expressed with DRAM1.
  • Tissue specificity

    Expression is down-regulated in ovarian tumors (at protein level). Widely expressed with highest levels in placenta and heart. Not detected in brain or thymus.
  • Sequence similarities

    Belongs to the DRAM/TMEM150 family.
  • Cellular localization

    Lysosome membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2010305N14Rik antibody
    • 2610318G18Rik antibody
    • AI647667 antibody
    • damage regulated autophagy modulator 2 antibody
    • DNA damage regulated autophagy modulator 2 antibody
    • DNA damage regulated autophagy modulator protein 2 antibody
    • DNA damage-regulated autophagy modulator protein 2 antibody
    • Dram2 antibody
    • DRAM2_HUMAN antibody
    • PRO180 antibody
    • PSEC0031 antibody
    • RP5-1180E21.1 antibody
    • Tmem77 antibody
    • Transmembrane protein 77 antibody
    • WWFQ154 antibody
    see all

Images

  • All lanes : Anti-DRAM2 antibody (ab230191) at 1/1000 dilution

    Lane 1 : Mouse heart tissue lysate
    Lane 2 : Mouse liver tissue lysate

    Secondary
    All lanes : Goat anti-rabbit IgG at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 30 kDa
    Observed band size: 30 kDa

  • Paraffin-embedded human bladder cancer tissue stained for DRAM2 with ab230191 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human heart tissue stained for DRAM2 with ab230191 at 1/100 dilution in immunohistochemical analysis.

  • MCF7 (human breast adenocarcinoma cell line) cells stained for DRAM2 (green) using ab230191 at 1/100 dilution in ICC/IF.

    The secondary antibody is an AlexaFluor® 488-conjugated Goat anti-Rabbit IgG (H+L).

References

ab230191 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230191.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up