Overview

  • Product name

  • Description

    Rabbit polyclonal to DRG1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment corresponding to Human DRG1 aa 173-228.
    Sequence:

    NSKPPNIGFKKKDKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLR SDATAD


    Database link: Q9Y295

  • Positive control

    • WB: HepG2 whole cell lysate. IHC-P: Human placenta and kidney tissues. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236958 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/200 - 1/5000. Predicted molecular weight: 41 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Function

    May play a role in cell proliferation, differentiation and death.
  • Tissue specificity

    High levels in skeletal muscle, heart, and kidney. Intermediate levels in liver, placenta and brain. Low levels in colon, thymus, spleen, small intestine, lung and leukocytes.
  • Sequence similarities

    Belongs to the GTP1/OBG family.
    Contains 1 G (guanine nucleotide-binding) domain.
  • Domain

    Its C-terminal domain interacts with TAL1.
  • Post-translational
    modifications

    Polyubiquitinated; which induces proteolytic degradation and is impaired by interaction with ZC3H15.
    Sumoylated by UBE2I in response to MEKK1-mediated stimuli.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Developmentally regulated GTP binding protein 1 antibody
    • Developmentally-regulated GTP-binding protein 1 antibody
    • DKFZp434N1827 antibody
    • DRG 1 antibody
    • DRG-1 antibody
    • DRG1 antibody
    • DRG1_HUMAN antibody
    • NEDD 3 antibody
    • NEDD-3 antibody
    • NEDD3 antibody
    • Neural precursor cell expressed developmentally down regulated protein 3 antibody
    • Neural precursor cell expressed developmentally down-regulated protein 3 antibody
    see all

Images

  • Anti-DRG1 antibody (ab236958) at 1/200 dilution + HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 41 kDa

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for DRG1 (green) using ab236958 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488-conjugated goat anti-rabbit IgG (H+L).

  • Paraffin-embedded human kidney tissue stained for DRG1 using ab236958 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human placenta tissue stained for DRG1 using ab236958 at 1/100 dilution in immunohistochemical analysis.

References

ab236958 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236958.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up