Overview

  • Product name

    Anti-DRG2 antibody - N-terminal
    See all DRG2 primary antibodies
  • Description

    Rabbit polyclonal to DRG2 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Guinea pig, Cow, Dog, Zebrafish
  • Immunogen

    Synthetic peptide within Human DRG2 aa 1-50 (N terminal). The exact sequence is proprietary. (NP_001379).
    Sequence:

    MGILEKISEIEKEIARTQKNKATEYHLGLLKAKLAKYRAQLLEPSKSASS


    Database link: P55039

  • Positive control

    • Human fetal kidney lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab186661 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 41 kDa.

Target

Images

  • Anti-DRG2 antibody - N-terminal (ab186661) at 1 µg/ml + Human fetal kidney lysate at 10 µg

    Predicted band size: 41 kDa

References

ab186661 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186661.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up