Overview

  • Product name

    Anti-DS-1 antibody
  • Description

    Rabbit polyclonal to DS-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human DS-1 aa 37-158.
    Sequence:

    TEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADSDIPLDRLTISYCRSSG PGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILT SESSRYQFRNLADCLQKIRDMI


    Database link: Q14197

  • Positive control

    • WB: RT4, U-251 MG sp and NBT-II cell lysates. IHC-P: Human rectum tissue.
  • General notes

    Previously labelled as ICT1.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224333 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 24 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Essential peptidyl-tRNA hydrolase component of the mitochondrial large ribosomal subunit. Acts as a codon-independent translation release factor that has lost all stop codon specificity and directs the termination of translation in mitochondrion, possibly in case of abortive elongation. May be involved in the hydrolysis of peptidyl-tRNAs that have been prematurely terminated and thus in the recycling of stalled mitochondrial ribosomes.
  • Tissue specificity

    Down-regulated during the in vitro differentiation of HT29-D4 colon carcinoma cells.
  • Sequence similarities

    Belongs to the prokaryotic/mitochondrial release factor family. ICT1 subfamily.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • Digestion substraction 1 antibody
    • DS-1 antibody
    • DS1 antibody
    • Ict1 antibody
    • ICT1_HUMAN antibody
    • Immature colon carcinoma transcript 1 antibody
    • Immature colon carcinoma transcript 1 protein antibody
    • mitochondrial antibody
    • Peptidyl-tRNA hydrolase ICT1 antibody
    • Peptidyl-tRNA hydrolase ICT1, mitochondrial antibody
    see all

Images

  • Paraffin-embedded human rectum tissue stained for DS-1 using ab224333 at 1/50 dilution in immunohistochemical analysis.

  • All lanes : Anti-DS-1 antibody (ab224333) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG sp (human brain glioma cell line) cell lysate

    Developed using the ECL technique.

    Predicted band size: 24 kDa

  • All lanes : Anti-DS-1 antibody (ab224333) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embryonic fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate

    Developed using the ECL technique.

    Predicted band size: 24 kDa

References

ab224333 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224333.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up