Overview

  • Product name

  • Description

    Rabbit polyclonal to DSCR1L1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cow, Chimpanzee, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human DSCR1L1 aa 88-197.
    Sequence:

    VQTPETDGDKLHLAPPQPAKQFLISPPSSPPVGWQPINDATPVLNYDLLY AVAKLGPGEKYELHAGTESTPSVVVHVCDSDIEEEEDPKTSPKPKIIQTR RPGLPPSVSN


    Database link: Q14206

  • Positive control

    • WB: Mouse heart tissue lysate. IHC-P: Human brain tissue. ICC/IF: A549 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab234856 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 21 kDa.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

Images

  • A549 (Human lung carcinoma cell line) cells labeling DSCR1L1 (green) using ab234856 at 1/100 dilution in ICC/IF. Secondary antibody was an Alexa Fluor® 488-conjugated goat anti-rabbit IgG (H+L).

  • Anti-DSCR1L1 antibody (ab234856) at 1/500 dilution + Mouse heart tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 21 kDa

  • Paraffin-embedded human brain tissue stained for DSCR1L1 using ab234856 at 1/100 dilution in immunohistochemical analysis.

References

ab234856 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234856.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up