Overview

  • Product name

    Anti-DSE antibody
  • Description

    Rabbit polyclonal to DSE
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment corresponding to Human DSE aa 23-270.
    Sequence:

    YITDENPEVMIPFTNANYDSHPMLYFSRAEVAELQLRAASSHEHIAARLT EAVHTMLSSPLEYLPPWDPKDYSARWNEIFGNNLGALAMFCVLYPENIEA RDMAKDYMERMAAQPSWLVKDAPWDEVPLAHSLVGFATAYDFLYNYLSKT QQEKFLEVIANASGYMYETSYRRGWGFQYLHNHQPTNCMALLTGSLVLMN QGYLQEAYLWTKQVLTIMEKSLVLLREVTDGSLYEGVAYGSYTTRSLF


    Database link: Q9UL01

  • Positive control

    • IHC-P: Human kidney and liver cancer tissue. ICC/IF: U-251 MG cells.
  • General notes

     This product was previously labelled as SART2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238873 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    Converts D-glucuronic acid to L-iduronic acid (IdoUA) residues.
  • Tissue specificity

    Ubiquitously expressed with higher expression in kidney and ovary and lower expression in brain, colon and thymus. Also expressed in renal cell carcinomas, brain tumors, and in a part of melanomas and adenocarcinomas from organs other than the breast. Expressed in squamous cell carcinomas (SCC), glioma, and some adenocarcinoma cell lines, but not in breast cancer cell lines or any normal tissues (at protein level).
  • Pathway

    Glycan metabolism; chondroitin sulfate biosynthesis.
    Glycan metabolism; heparan sulfate biosynthesis.
  • Sequence similarities

    Belongs to the dermatan-sulfate isomerase family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Chondroitin glucuronate 5 epimerase antibody
    • Chondroitin-glucuronate 5-epimerase antibody
    • Dermatan sulfate epimerase antibody
    • Dermatan-sulfate epimerase antibody
    • DS epimerase antibody
    • DSE antibody
    • DSE_HUMAN antibody
    • DSEPI antibody
    • OTTHUMP00000040406 antibody
    • SART 2 antibody
    • SART-2 antibody
    • Squamous cell carcinoma antigen recognized by T cells 2 antibody
    • Squamous cell carcinoma antigen recognized by T-cells 2 antibody
    see all

Images

  • U-251 MG (human brain glioma cell line) cells stained for DSE (green) using ab238873 at 1/100 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human liver cancer tissue stained for DSE using ab238873 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for DSE using ab238873 at 1/100 dilution in immunohistochemical analysis.

References

ab238873 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238873.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up