Overview

  • Product name

  • Description

    Rabbit polyclonal to DSN1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human DSN1 aa 1-356.
    Sequence:

    MTSVTRSEIIDEKGPVMSKTHDHQLESSLSPVEVFAKTSASLEMNQGVSE ERIHLGSSPKKGGNCDLSHQERLQSKSLHLSPQEQSASYQDRRQSWRRAS MKETNRRKSLHPIHQGITELSRSISVDLAESKRLGCLLLSSFQFSIQKLE PFLRDTKGFSLESFRAKASSLSEELKHFADGLETDGTLQKCFEDSNGKAS DFSLEASVAEMKEYITKFSLERQTWDQLLLHYQQEAKEILSRGSTEAKIT EVKVEPMTYLGSSQNEVLNTKPDYQKILQNQSKVFDCMELVMDELQGSVK QLQAFMDESTQCFQKVSVQLGKRSMQQLDPSPARKLLKLQLQNPPAIHGS GSGSCQ


    Database link: Q9H410

  • Positive control

    • IHC-P: Human brain tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235307 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Part of the MIS12 complex which is required for normal chromosome alignment and segregation and kinetochore formation during mitosis.
  • Cellular localization

    Nucleus. Chromosome > centromere > kinetochore. Associated with the kinetochore.
  • Information by UniProt
  • Database links

  • Alternative names

    • C20orf172 antibody
    • Chromosome 20 open reading frame 172 antibody
    • dJ469A13.2 antibody
    • DSN1 antibody
    • DSN1, MIND kinetochore complex component, homolog antibody
    • DSN1, MIND kinetochore complex component, homolog (S. cerevisiae) antibody
    • DSN1, MIS12 kinetochore complex component antibody
    • DSN1_HUMAN antibody
    • FLJ13346 antibody
    • hKNL-3 antibody
    • Kinetochore associated protein DSN1 antibody
    • Kinetochore associated protein DSN1 homolog antibody
    • Kinetochore null 3 homolog antibody
    • Kinetochore-associated protein DSN1 homolog antibody
    • KNL3 antibody
    • MGC32987 antibody
    • MIS13 antibody
    see all

Images

  • Paraffin-embedded human brain tissue stained for DSN1 using ab235307 at 1/100 dilution in immunohistochemical analysis.

References

ab235307 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235307.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up