Overview

  • Product name

  • Description

    Rabbit polyclonal to DSTN
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Cow, Pig
  • Immunogen

    Recombinant full length protein corresponding to Human DSTN aa 2-165.
    Sequence:

    ASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEE GKEILVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMF FLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGPEDLNRACIAEK LGGSLIVAFEGCPV


    Database link: P60981-1

  • Positive control

    • IHC-P: Human prostate cancer and bladder tissue.
  • General notes

    Previously labelled as Destrin. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238115 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

Images

  • Paraffin-embedded human prostate cancer tissue stained for DSTN using ab238115 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human bladder tissue stained for DSTN using ab238115 at 1/100 dilution in immunohistochemical analysis.

References

ab238115 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238115.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up