Overview

  • Product name

  • Description

    Rabbit polyclonal to DTX2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DTX2 aa 1-280.
    Sequence:

    MAMAPSPSLVQVYTSPAAVAVWEWQDGLGTWHPYSATVCSFIEQQFVQQK GQRFGLGSLAHSIPLGQADPSLAPYIIDLPSWTQFRQDTGTMRAVRRHLF PQHSAPGRGVVWEWLSDDGSWTAYEASVCDYLEQQVARGNQLVDLAPLGY NYTVNYTTHTQTNKTSSFCRSVRRQAGPPYPVTTIIAPPGHTGVACSCHQ CLSGSRTGPVSGRYRHSMTNLPAYPVPQHPPHRTASVFGTHQAFAPYNKP SLSGARSAPRLNTTNAWGAAPPSLGSQPLY


    Database link: Q86UW9

  • Positive control

    • IHC-P: Human thyroid tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235403 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. Probably acts both as a positive and negative regulator of Notch, depending on the developmental and cell context. Mediates the antineural activity of Notch, possibly by inhibiting the transcriptional activation mediated by MATCH1. Functions as an ubiquitin ligase protein in vitro, suggesting that it may regulate the Notch pathway via some ubiquitin ligase activity.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the Deltex family.
    Contains 1 RING-type zinc finger.
    Contains 2 WWE domains.
  • Domain

    The WWE domains are thought to mediate some protein-protein interaction, and are frequently found in ubiquitin ligases.
  • Cellular localization

    Cytoplasm. Nucleus. Predominantly cytoplasmic. Partially nuclear.
  • Information by UniProt
  • Database links

  • Alternative names

    • Deltex 2 antibody
    • deltex homolog 2 (Drosophila) antibody
    • deltex, Drosophila, homolog of, 2 antibody
    • Deltex2 antibody
    • DTX2 antibody
    • DTX2_HUMAN antibody
    • hDTX2 antibody
    • Highly similar to hPMSR6 [H.sapiens] antibody
    • KIAA1528 antibody
    • Probable E3 ubiquitin-protein ligase DTX2 antibody
    • Protein deltex 2 antibody
    • Protein deltex-2 antibody
    • RING finger protein 58 antibody
    • RNF58 antibody
    • Zinc ion binding protein antibody
    see all

Images

  • Paraffin-embedded human thyroid tissue stained for DTX2 using ab235403 at 1/100 dilution in immunohistochemical analysis.

References

ab235403 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235403.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up