Overview

  • Product name

    Anti-DUBA2 antibody
  • Description

    Rabbit polyclonal to DUBA2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DUBA2 aa 59-129.
    Sequence:

    HRQELEKFQDDSSIESVVEDLAKMNLENRPPRSSKAHRKRERMESEERER QESIFQAEMSEHLAGFKREEE


    Database link: Q7L8S5

  • Positive control

    • Human breast tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab185352 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunohistochemical analysis of human breast tissue labeling DUBA2 with an185352 at 1/500 dilution.

References

ab185352 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185352.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up