Overview

  • Product name

  • Description

    Rabbit polyclonal to DUOX1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Dog, Pig
  • Immunogen

    Recombinant fragment corresponding to Human DUOX1 aa 1312-1551.
    Sequence:

    ALGTTEYHPFTLTSAPHEDTLSLHIRAAGPWTTRLREIYSAPTGDRCARY PKLYLDGPFGEGHQEWHKFEVSVLVGGGIGVTPFASILKDLVFKSSVSCQ VFCKKIYFIWVTRTQRQFEWLADIIREVEENDHQDLVSVHIYITQLAEKF DLRTTMLYICERHFQKVLNRSLFTGLRSITHFGRPPFEPFFNSLQEVHPQ VRKIGVFSCGPPGMTKNVEKACQLINRQDRTHFSHHYENF


    Database link: Q9NRD9

  • Positive control

    • IHC-P: Human testis and pancreatic tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab230209 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Relevance

    The protein encoded by this gene is a glycoprotein and a member of the NADPH oxidase family. The synthesis of thyroid hormone is catalyzed by a protein complex located at the apical membrane of thyroid follicular cells. This complex contains an iodide transporter, thyroperoxidase, and a peroxide generating system that includes this encoded protein and DUOX2. This protein is known as dual oxidase because it has both a peroxidase homology domain and a gp91phox domain. Two alternatively spliced transcript variants encoding the same protein have been described for this gene (from EntrezGene).
  • Cellular localization

    Cell Membrane
  • Database links

  • Alternative names

    • Dual oxidase 1 antibody
    • Dual oxidase 1 precursor antibody
    • DUOX1 antibody
    • EC 1.11.1 antibody
    • EC 1.6.3.1 antibody
    • Flavoprotein NADPH oxidase antibody
    • Large NOX 1 antibody
    • LNOX1 antibody
    • Long NOX 1 antibody
    • MGC138840 antibody
    • MGC138841 antibody
    • NADPH thyroid oxidase 1 antibody
    • Nicotinamide adenine dinucleotide phosphate oxidase antibody
    • NOXEF1 antibody
    • THOX1 antibody
    • Thyroid oxidase 1 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for DUOX1 using ab230209 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreatic tissue stained for DUOX1 using ab230209 at 1/100 dilution in immunohistochemical analysis.

References

ab230209 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230209.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up