Overview

  • Product name

    Anti-DUSP12 antibody [28F3]
    See all DUSP12 primary antibodies
  • Description

    Mouse monoclonal [28F3] to DUSP12
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human DUSP12 aa 1-340. Purified from E. coli.
    Sequence:

    MLEAPGPSDGCELSNPSASRVSCAGQMLEVQPGLYFGGAAAVAEPDHLRE AGITAVLTVDSEEPSFKAGPGVEDLWRLFVPALDKPETDLLSHLDRCVAF IGQARAEGRAVLVHCHAGVSRSVAIITAFLMKTDQLPFEKAYEKLQILKP EAKMNEGFEWQLKLYQAMGYEVDTSSAIYKQYRLQKVTEKYPELQNLPQE LFAVDPTTVSQGLKDEVLYKCRKCRRSLFRSSSILDHREGSGPIAFAHKR MTPSSMLTTGRQAQCTSYFIEPVQWMESALLGVMDGQLLCPKCSAKLGSF NWYGEQCSCGRWITPAFQIHKNRVDEMKILPVLGSQTGKI


    Database link: Q9UNI6

  • Positive control

    • WB: Bosc23 cell lysate transfected with Myc/DUSP12.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.03% Sodium azide
    Constituents: HEPES, 0.87% Sodium chloride, 0.01% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Ammonium Sulphate Precipitation
  • Purification notes

    Purified from TCS.
  • Clonality

    Monoclonal
  • Clone number

    28F3
  • Isotype

    IgG2a
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab237008 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Predicted molecular weight: 38 kDa.

Target

  • Tissue specificity

    Ubiquitous, highest expression in spleen, testis, ovary, and peripheral blood leukocytes and lower expression in liver and lung.
  • Sequence similarities

    Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
    Contains 1 tyrosine-protein phosphatase domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Dual specificity phosphatase 12 antibody
    • Dual specificity protein phosphatase 12 antibody
    • Dual specificity tyrosine phosphatase YVH1 antibody
    • DUS12_HUMAN antibody
    • DUSP 1 antibody
    • DUSP 12 antibody
    • DUSP1 antibody
    • DUSP12 antibody
    • Serine/threonine specific protein phosphatase antibody
    • TDSP4 antibody
    • YVH 1 antibody
    • YVH1 antibody
    • YVH1 protein tyrosine phosphatase (S. cerevisiae) ortholog antibody
    • YVH1 protein tyrosine phosphatase ortholog antibody
    see all

Images

  • All lanes : Anti-DUSP12 antibody [28F3] (ab237008) at 1/2000 dilution

    Lane 1 : Bosc23 cell lysate
    Lane 2 : Bosc23 cell lysate transfected with Myc/DUSP12
    Lane 3 : Bosc23 cell lysate transfected with Myc/PEZ
    Lane 4 : Bosc23 cell lysate transfected with GFP/Ub

    Predicted band size: 38 kDa



    Incubated with primary antibody at 4°C overnight, followed by secondary antibody incubation for 1 hour at room temperature.

References

ab237008 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237008.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up