Overview

  • Product name

  • Description

    Rabbit polyclonal to DUSP26
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human DUSP26 aa 2-92.
    Sequence:

    CPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERL LYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVL


    Database link: Q9BV47

  • Positive control

    • IHC-P: Human prostate tissue. WB: DUSP26 overexpression HEK-293T lysate. ICC/IF: SH-SY5Y cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224407 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 24 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Inactivates MAPK1 and MAPK3 which leads to dephosphorylation of heat shock factor protein 4 and a reduction in its DNA-binding activity. Inhibits MAP kinase p38 by dephosphorylating it and inhibits p38-mediated apoptosis in anaplastic thyroid cancer cells. Can also induce activation of MAP kinase p38 and c-Jun N-terminal kinase (JNK).
  • Tissue specificity

    Brain. In the brain it is expressed ubiquitously except in the hippocampus. Expressed in embryonal cancers (retinoblastoma, neuroepithilioma and neuroblastoma) and in anaplatic thyroid cancer.
  • Sequence similarities

    Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
    Contains 1 tyrosine-protein phosphatase domain.
  • Cellular localization

    Cytoplasm. Nucleus. Golgi apparatus.
  • Information by UniProt
  • Database links

  • Alternative names

    • DSP-4 antibody
    • Dual specificity phosphatase 26 (putative) antibody
    • Dual specificity phosphatase 26 antibody
    • Dual specificity phosphatase SKRP3 antibody
    • Dual specificity protein phosphatase 26 antibody
    • DUS26_HUMAN antibody
    • DUSP24 antibody
    • DUSP26 antibody
    • Hypothetical protein FLJ31142 antibody
    • LDP 4 antibody
    • LDP-4 antibody
    • Low molecular mass dual specificity phosphatase 4 antibody
    • Low-molecular-mass dual-specificity phosphatase 4 antibody
    • MAP kinase phosphatase 8 antibody
    • MGC1136 antibody
    • MGC2627 antibody
    • Mitogen activated protein kinase phosphatase 8 antibody
    • Mitogen-activated protein kinase phosphatase 8 antibody
    • MKP-8 antibody
    • MKP8 antibody
    • NATA1 antibody
    • NATA1 protein antibody
    • Novel amplified gene in thyroid anaplastic cancer antibody
    • SKRP3 antibody
    see all

Images

  • All lanes : Anti-DUSP26 antibody (ab224407) at 1/100 dilution

    Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) lysate
    Lane 2 : DUSP26 overexpression HEK-293T (co-expressed with a C terminal myc-DDK tag, ~3.1 kDa) lysate

    Predicted band size: 24 kDa

  • Paraffin-embedded human prostate tissue stained for DUSP26 using ab224407 at 1/50 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized SH-SY5Y (human neuroblastoma cell line from bone marrow) cells stained for DUSP26 (green) using ab224407 at 4 µg/ml in ICC/IF.

References

ab224407 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224407.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up