Overview

  • Product name

  • Description

    Rabbit polyclonal to DUSP6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment within Human DUSP6 aa 206-381. The exact sequence is proprietary. (With tag; BC005047).
    Sequence:

    FPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFKY KQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRSVTVTV AYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDN RVPAQQLYFTTPSNQNVYQVDSLQST


    Database link: Q16828

  • Positive control

    • Jurkat and Human fetal kidney tissue lysates; Human ovarian cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.05% Sodium azide
    Constituents: 50% Glycerol, 49% PBS

    Note: PBS without Mg2+ and Ca2+.
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab182605 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 42, 27 kDa.
IHC-P 1/25 - 1/100.

Target

  • Function

    Inactivates MAP kinases. Has a specificity for the ERK family.
  • Sequence similarities

    Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
    Contains 1 rhodanese domain.
    Contains 1 tyrosine-protein phosphatase domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Dual specificity phosphatase 6 antibody
    • Dual specificity phosphatase 6 isoform a antibody
    • Dual specificity protein phosphatase 6 antibody
    • Dual specificity protein phosphatase PYST1 antibody
    • DUS6_HUMAN antibody
    • DUSP 6 antibody
    • DUSP 6a antibody
    • Dusp6 antibody
    • DUSP6a antibody
    • HH19 antibody
    • MAP kinase phosphatase 3 antibody
    • Mitogen activated protein kinase phosphatase 3 antibody
    • Mitogen-activated protein kinase phosphatase 3 antibody
    • MKP 3 antibody
    • MKP-3 antibody
    • MKP3 antibody
    • PYST 1 antibody
    • PYST1 antibody
    • Serine/threonine specific protein phosphatase antibody
    see all

Images

  • All lanes : Anti-DUSP6 antibody (ab182605) at 1/450 dilution

    Lane 1 : Jurkat cell lysate
    Lane 2 : Human fetal kidney tissue lysate

    Lysates/proteins at 30 µg per lane.

    Secondary
    All lanes : Goat anti Rabbit IgG - H&L (HRP) at 1/10000 dilution

    Predicted band size: 42, 27 kDa


    Exposure time: 1 minute


    Gel: 10% SDS-PAGE

  • Immunohistochemical analysis of paraffin-embedded Human ovarian cancer tissue labeling DUSP6 with ab182605 at 1/25 dilution (left panel). Right panel treated with the immunogen.

References

This product has been referenced in:

  • Carpio LR  et al. Histone deacetylase 3 suppresses Erk phosphorylation and matrix metalloproteinase (Mmp)-13 activity in chondrocytes. Connect Tissue Res 58:27-36 (2017). Read more (PubMed: 27662443) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182605.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up