
  • Product name

    Anti-DUXA antibody
  • Description

    Rabbit polyclonal to DUXA
  • Host species

  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 154-203 (SRLLLQRKREPVASLEQEEQGKIPEGLQGAEDTQNGTNFTSDSHFSGAR T) of Human DUXA (NP_001012747)

  • Positive control

    • Human fetal stomach lysate



Our Abpromise guarantee covers the use of ab99058 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 24 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.



  • Anti-DUXA antibody (ab99058) at 1 µg/ml + Human fetal stomach lysate at 10 µg

    Predicted band size: 24 kDa

    Gel concentration 12%


ab99058 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99058.
Please use the links above to contact us or submit feedback about this product.

For licensing inquiries, please contact partnerships@abcam.com

Sign up