Overview

  • Product name

  • Description

    Rabbit polyclonal to DYNC2H1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human DYNC2H1 aa 1928-2065.
    Sequence:

    GIELKEVEYDELSAALKQVFEEANYEIIPNQIKKALELYEQLCQRMGVVI VGPSGAGKSTLWRMLRAALCKTGKVVKQYTMNPKAMPRYQLLGHIDMDTR EWSDGVLTNSARQVVREPQDVSSWIICDGDIDPEWIES


    Database link: Q8NCM8

  • Positive control

    • WB: Recombinant Human DYNC2H1 protein with N-terminal GST tag. IHC-P: Human testis and small intestine tissues. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab225946 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 493 kDa.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    May function as a motor for intraflagellar retrograde transport. Functions in cilia biogenesis. May play a role in transport between endoplasmic reticulum and Golgi or organization of the Golgi in cells.
  • Involvement in disease

    Defects in DYNC2H1 are the cause of asphyxiating thoracic dystrophy type 3 (ATD3) [MIM:613091]. ATD3 is an autosomal recessive osteochondrodysplasia which often leads to death in infancy because of a severely constricted thoracic cage and respiratory insufficiency.
    Defects in DYNC2H1 are the cause of short rib-polydactyly syndrome type 3 (SRPS3) [MIM:263510]; also called Verma-Naumoff syndrome. A lethal skeletal dysplasia characterized by markedly short ribs, short limbs, polydactyly, narrow thorax, and multiple anomalies of major organs, including heart, intestines, genitalia, kidney, liver, and pancreas.
  • Sequence similarities

    Belongs to the dynein heavy chain family.
  • Cellular localization

    Cytoplasm > cytoskeleton > cilium axoneme. Cell membrane. Cytoplasm. Localizes to the apical cytoplasm (By similarity). According to PubMed:8666668, it localizes to Golgi apparatus, cytoplasmic vesicle and endoplasmic reticulum.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cytoplasmic dynein 2 heavy chain 1 antibody
    • Cytoplasmic dynein 2 heavy chain antibody
    • DYHC2_HUMAN antibody
    • DYNC2H1 antibody
    • Dynein cytoplasmic heavy chain 2 antibody
    • Dynein heavy chain 11 antibody
    • Dynein heavy chain isotype 1B antibody
    • hDHC11 antibody
    see all

Images

  • All lanes : Anti-DYNC2H1 antibody (ab225946) at 1/500 dilution

    Lane 1 : Recombinant Human DYNC2H1 protein with N-terminal GST tag, 80 ng
    Lane 2 : Recombinant Human DYNC2H1 protein with N-terminal GST tag, 40 ng
    Lane 3 : Recombinant Human DYNC2H1 protein with N-terminal GST tag, 20 ng

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 493 kDa



    Predicted MW of recombinant protein: 45 kDa.

  • Paraffin-embedded human testis tissue stained for DYNC2H1 with ab225946 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human small intestine tissue stained for DYNC2H1 with ab225946 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for DYNC2H1 (green) using ab225946 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® congugated Goat Anti-Rabbit IgG (H+L).

References

ab225946 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225946.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up