Overview

  • Product name

  • Description

    Rabbit polyclonal to DYNC2LI1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein corresponding to Human DYNC2LI1 aa 1-352.
    Sequence:

    MPSETLWEIAKAEVEKRGINGSEGDGAEIAEKFVFFIGSKNGGKTTIILR CLDRDEPPKPTLALEYTYGRRAKGHNTPKDIAHFWELGGGTSLLDLISIP ITGDTLRTFSLVLVLDLSKPNDLWPTMENLLQATKSHVDKVIMKLGKTNA KAVSEMRQKIWNNMPKDHPQDHELIDPFPVPLVIIGSKYDVFQDFESEKR KVICKTLRFVAHYYGASLMFTSKSEALLLKIRGVINQLAFGIDKSKSICV DQNKPLFITAGLDSFGQIGSPPVPENDIGKLHAHSPMELWKKVYEKLFPP KSINTLKDIKDPARDPQYAENEVDEMRIQKDLELEQYKRSSSKSWKQIEL DS


    Database link: Q8TCX1-2

  • Positive control

    • WB: HEK-293T and A549 whole cell lysates; Mouse gonadal lysate. IHC-P: Human glioma cancer and liver tissues.
  • General notes

     This product was previously labelled as DC2L1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230396 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 40 kDa (predicted molecular weight: 40 kDa).

Target

Images

  • All lanes : Anti-DYNC2LI1 antibody (ab230396) at 1/1000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 2 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 3 : Mouse gonadal lysate

    Secondary
    All lanes : Goat anti-rabbit IgG at 1/10000 dilution

    Predicted band size: 40 kDa
    Observed band size: 40 kDa

  • Paraffin-embedded human liver tissue stained for DYNC2LI1 using ab230396 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human glioma cancer tissue stained for DYNC2LI1 using ab230396 at 1/100 dilution in immunohistochemical analysis.

References

ab230396 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230396.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up