Overview

  • Product name

    Anti-Dynein heavy chain antibody
    See all Dynein heavy chain primary antibodies
  • Description

    Rabbit polyclonal to Dynein heavy chain
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Dynein heavy chain aa 676-754.
    Sequence:

    YNLSQPLLKRDPETKEITINFNPQLISVLKEMSYLEPREMKHMPETAAAM FSSRDFYRQLVANLELMANWYNKVMKTLL


    Database link: Q9NYC9

  • Positive control

    • Human fallopian tube tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab204048 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP.
  • Sequence similarities

    Belongs to the dynein heavy chain family.
  • Domain

    Dynein heavy chains probably consist of an N-terminal stem (which binds cargo and interacts with other dynein components), and the head or motor domain. The motor contains six tandemly-linked AAA domains in the head, which form a ring. A stalk-like structure (formed by two of the coiled coil domains) protrudes between AAA 4 and AAA 5 and terminates in a microtubule-binding site. A seventh domain may also contribute to this ring; it is not clear whether the N-terminus or the C-terminus forms this extra domain. There are four well-conserved and two non-conserved ATPase sites, one per AAA domain. Probably only one of these (within AAA 1) actually hydrolyzes ATP, the others may serve a regulatory function.
  • Cellular localization

    Cytoplasm, cytoskeleton, cilium axoneme.
  • Information by UniProt
  • Database links

  • Alternative names

    • axonemal antibody
    • Axonemal beta dynein heavy chain 9 antibody
    • Ciliary dynein heavy chain 9 antibody
    • Ciliary dynein heavy chain antibody
    • DNAH 9 antibody
    • DNAH17L antibody
    • DNAH9 antibody
    • DNAH9 variant protein antibody
    • Dnahc 9 antibody
    • Dnahc9 antibody
    • DNAL 1 antibody
    • DNAL1 antibody
    • DNEL 1 antibody
    • DNEL1 antibody
    • DYH 9 antibody
    • DYH9 antibody
    • DYH9_HUMAN antibody
    • Dynein axonemal heavy chain 9 antibody
    • Dynein axonemal heavy polypeptide 17 like antibody
    • Dynein axonemal heavy polypeptide 9 antibody
    • Dynein heavy chain 9 antibody
    • dynein heavy chain 9, axonemal antibody
    • HL 20 antibody
    • HL20 antibody
    • KIAA0357 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human fallopian tube tissue labeling Dynein heavy chain with ab204048 at 1/200 dilution.

References

ab204048 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (htertRPE)
Permeabilization
No
Specification
htertRPE
Blocking step
Serum as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 25°C
Fixative
Methanol

Oliva Palander

Verified customer

Submitted Sep 20 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up