Overview

  • Product name

    Anti-Dynein light chain antibody
    See all Dynein light chain primary antibodies
  • Description

    Rabbit polyclonal to Dynein light chain
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow, Pig
  • Immunogen

    Recombinant full length protein corresponding to Human Dynein light chain aa 1-105.
    Sequence:

    MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNN ESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVC VWKCS


    Database link: O96015

  • Positive control

    • WB: Mouse gonadal and brain lysates; HL-60 and NIH/3T3 whole cell lysates. IHC-P: Human testis and breast cancer tissues. ICC/IF: MCF7 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236594 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 12 kDa.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

Images

  • All lanes : Anti-Dynein light chain antibody (ab236594) at 1/500 dilution

    Lane 1 : Mouse gonadal lysate
    Lane 2 : HL-60 (human promyelocytic leukemia cell line) whole cell lysate
    Lane 3 : NIH/3T3 (mouse embyro fibroblast cell line) whole cell lysate
    Lane 4 : Mouse brain lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 12 kDa

  • Paraffin-embedded human testis tissue stained for Dynein light chain using ab236594 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human breast cancer tissue stained for Dynein light chain using ab236594 at 1/100 dilution in immunohistochemical analysis.

  • MCF7 (human breast adenocarcinoma cell line) cells stained for Dynein light chain (green) using ab236594 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236594 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236594.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up