Overview

  • Product name

  • Description

    Rabbit polyclonal to DYNLL1/PIN
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Rabbit, Cow, Drosophila melanogaster, Cynomolgus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human DYNLL1/PIN aa 1-89.
    Sequence:

    MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKY NPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG


    Database link: P63167

  • Positive control

    • MCF7, Mouse brain, HepG2, 293T, HeLa and U-251MG cell extracts.
  • General notes

    Previously labelled as DYNLL1. 

Properties

Applications

Our Abpromise guarantee covers the use of ab189854 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 10 kDa.
IHC-P 1/50 - 1/200.

Target

  • Function

    Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures.
    Binds and inhibits the catalytic activity of neuronal nitric oxide synthase.
    Promotes transactivation functions of ESR1 and plays a role in the nuclear localization of ESR1.
    Regulates apoptotic activities of BCL2L11 by sequestering it to microtubules. Upon apoptotic stimuli the BCL2L11-DYNLL1 complex dissociates from cytoplasmic dynein and translocates to mitochondria and sequesters BCL2 thus neutralizing its antiapoptotic activity.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the dynein light chain family.
  • Post-translational
    modifications

    Phosphorylation at Ser-88 appears to control the dimer-monomer transition. According to PubMed:15193260, it is phosphorylated at Ser-88 by PAK1, however, according to PubMed:18650427, the DYNLL1 dimer is not accessible for PAK1 and the phosphorylation could not be demonstrated in vitro.
  • Cellular localization

    Cytoplasm, cytoskeleton. Nucleus. Mitochondrion. Upon induction of apoptosis translocates together with BCL2L11 to mitochondria.
  • Information by UniProt
  • Database links

  • Alternative names

    • 8 kDa dynein light chain antibody
    • 8kDLC antibody
    • Cytoplasmic dynein light polypeptide antibody
    • DLC1 antibody
    • DLC8 antibody
    • DNCL1 antibody
    • DNCLC1 antibody
    • DYL1_HUMAN antibody
    • Dynein , cytoplasmic, light chain 1 antibody
    • Dynein light chain 1 cytoplasmic antibody
    • Dynein light chain 1, cytoplasmic antibody
    • Dynein light chain LC8 type 1 antibody
    • Dynein light chain LC8-type 1 antibody
    • Dynein, cytoplasmic, light polypeptide 1 antibody
    • Dynein, light chain, LC8-type 1 antibody
    • DYNLL1 antibody
    • HDLC1 antibody
    • LC8 antibody
    • LC8a antibody
    • MGC126137 antibody
    • MGC126138 antibody
    • MGC72986 antibody
    • PIN antibody
    • Protein inhibitor of neuronal nitric oxide synthase antibody
    • Protein inhibitor of neuronal NOS antibody
    see all

Images

  • All lanes : Anti-DYNLL1/PIN antibody (ab189854) at 1/500 dilution

    Lane 1 : MCF7 cell extract
    Lane 2 : 293T cell extract
    Lane 3 : HepG2 cell extract
    Lane 4 : U-251MG cell extract
    Lane 5 : HeLa cell extract
    Lane 6 : Mouse brain extract

    Predicted band size: 10 kDa

References

ab189854 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189854.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up