
  • Product name

  • Description

    Sheep polyclonal to DYRK1A
  • Host species

  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human DYRK1A aa 486-763.
    Database link: Q13627


  • Form

  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.08% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Ammonium Sulphate Precipitation
  • Purification notes

    This antibody is provided as a 0.2 µm sterile filtered solution.
  • Clonality

  • Isotype

  • Research areas

Associated products


Our Abpromise guarantee covers the use of ab16140 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 85 kDa.
IP Use a concentration of 2 µg/ml.


  • Function

    May play a role in a signaling pathway regulating nuclear functions of cell proliferation. Phosphorylates serine, threonine and tyrosine residues in its sequence and in exogenous substrates.
  • Tissue specificity

    Ubiquitous. Highest levels in skeletal muscle, testis, fetal lung and fetal kidney.
  • Involvement in disease

    Defects in DYRK1A are the cause of mental retardation autosomal dominant type 7 (MRD7) [MIM:614104]. A disease characterized by primary microcephaly, severe mental retardation without speech, anxious autistic behavior, and dysmorphic features, including bitemporal narrowing, deep-set eyes, large simple ears, and a pointed nasal tip. Mental retardation is characterized by significantly below average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MNB/DYRK subfamily.
    Contains 1 protein kinase domain.
  • Developmental stage

    Expressed in the developing central nervous system. Overexpressed 1.5-fold in fetal Down syndrome brain.
  • Domain

    The polyhistidine repeats act as targeting signals to nuclear speckles (PubMed:19266028).
  • Post-translational

    Autophosphorylated on tyrosine residues.
  • Cellular localization

    Nucleus speckle.
  • Information by UniProt
  • Database links

  • Alternative names

    • Dual specificity tyrosine phosphorylation regulated kinase antibody
    • Dual specificity tyrosine (Y) phosphorylation regulated kinase 1A antibody
    • Dual specificity tyrosine phosphorylation regulated kinase 1 antibody
    • Dual specificity tyrosine phosphorylation regulated kinase 1A antibody
    • Dual specificity tyrosine-phosphorylation-regulated kinase 1A antibody
    • Dual specificity YAK 1 related kinase antibody
    • Dual specificity YAK1 related kinase antibody
    • Dual specificity YAK1-related kinase antibody
    • DYR1A_HUMAN antibody
    • DYRK 1 antibody
    • DYRK 1A antibody
    • DYRK antibody
    • DYRK1 antibody
    • Dyrk1a antibody
    • DYRKA antibody
    • hMNB antibody
    • HP 86 antibody
    • HP86 antibody
    • Minibrain (Drosophila) homolog antibody
    • Minibrain homolog antibody
    • Minibrain, Drosophila, homolog of antibody
    • MNB antibody
    • MNB protein kinase antibody
    • Mnb protein kinase homolog hp86 antibody
    • MNB protein kinase, Serine/threonine-specific antibody
    • MNB/DYRK protein kinase antibody
    • MNBH antibody
    • MRD7 antibody
    • OTTHUMP00000109090 antibody
    • OTTHUMP00000109091 antibody
    • OTTHUMP00000109094 antibody
    • OTTHUMP00000174799 antibody
    • Protein kinase minibrain homolog antibody
    • Serine/threonine kinase MNB antibody
    see all


ab16140 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A


Thank you for your enquiry. ab16140:The antigen made to generate the antibody is specific to Dyrk1A. That said, we have never actually tested against any other Dyrk protein, but the Dyrk1A sequence differs so greatly from Dyrk1B that it would be highly unlikely for the antibody to cross react. ab65220:The antibody only can detect DYRK1A according to the BLAST result. ab71464:There is no information on cross reactivity with 「DYRK1B」or「 DYRK2」. ab69811: Cross reactivity with DYRK1B and DYRK2 has not been tested. However using the immunising sequence suggested in the datasheet (733-752 a.a) in a BLAST search, it appears there is little homology between the immunising sequence and DYRK1B and DYRK2. I hope this information will be helpful.

Read More


Thank you for your enquiry. We do not have an anti-phospho specific antibody for DYRK1A at this time, but we gladly accept all suggestions and may decide to pursue this opportunity in the future. I hope this information helps, please do not hesitate to contact us if you need any more advice or information.

Read More


Thank you for your enquiry. The peptide used to produce this antibody was a recombinant fragment corresponding to amino acids 486-763 of Human DYRK1A. I did an alignment of this fragment of DYRK1A with the Drosophila sequence you provided to me, and it appears that this antibody would not be useful for you. There is not a good degree of homology between the sequences, so I don't believe this antibody will recognize the drosophila protein very well. Here are the reulsts of the alignment (I hope it shows up correctly in this email): SeqA Name Len(aa) SeqB Name Len(aa) Score =========================================================== 1 drosophila 843 2 immunogen 283 21 =========================================================== CLUSTAL W (1.82) multiple sequence alignment drosophila MHHHSSPSSSSEVRAMQARIPNHFREPASGPLRKLSVDLIKTYKHINEVYYAKKKRRAQQ 60 immunogen ------------------------------------------------------------ ::.::::. : .: .. ..::.. . : . .: . .. :... :.. drosophila TQGDDDSSNKKERKLYNDGYDDDNHDYIIKNGEKFLDRYEIDSLIGKGSFGQVVKAYDHE 120 immunogen ------------------------------------------------------------ :.....::.... . ... .... . ..... . . .: ...: .. .: . . drosophila EQCHVAIKIIKNKKPFLNQAQIEVKLLEMMNRADAENKYYIVKLKRHFMWRNHLCLVFEL 180 immunogen ------------------------------------------------------------ ... : . ..... ..:. . . . . :.:... . . . . . drosophila LSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPENILLCNPKR 240 immunogen ------------------------------------------------------------ : . . .:. . : . : . :.. .:: ::.. . .. .... .... drosophila SAIKIVDFGSSCQLGQRIYHYIQSRFYRSPEVLLGIQYDLAIDMWSLGCILVEMHTGEPL 300 immunogen ------------------------------------------------------------ :: . . .::.. .. .: :.. . . . : . : .. . :... drosophila FSGCNEVDQMNKIVEVLGMPPKYLLDQAHKTRKFFDKIVADGSYVLKKNQNGRKYKPPGS 360 immunogen ------------------------------------------------------------ :.... .. .. . . ... ..: .: . .. :..: ...... . ....: drosophila RKLHDILGVETGGPGGRRLDEPGHSVSDYLKFKDLILRMLDFDPKTRVTPYYALQHNFFK 420 immunogen ------------------------------------------------------------ . . . .:..... .... : :. . .. . ...: :. : . . . drosophila RTADEATNTSGAGATANAGAGGSGSSGAGGSSGGGVGGGLGASNSSSGAVSSSSAAAPTA 480 immunogen KTADEGTNTS--------------------------------NSVSTSPAMEQSQSSGTT 28 :****.****.:.:::.:.:..:.::.:..::... ... .:.. *:... ..* :: *: drosophila ATAAATAAGSSGSGSSVGGGSSAAQQQQAMPLPLPLPLPLPPLAGPGGASDGQCHGLLMH 540 immunogen SSTSSSSGGSSGTSNSGRARSDPTHQHRHS----------------GGHFTAAVQAMDCE 72 :::::::.****:..* . *..::*:: . . . . . .. :..** . :.: . drosophila SVAANAMNNFSALSLQSNAHPPPSLANSHHSTNSLGSLNHISPGSTGCHNNNSNSSNNNT 600 immunogen THSPQVRQQFPAPLGWSGTEAPTQVTVETHPVQET--TFHVAPQQNALHHHHGNSSHHHH 130 : :.:. ::*.* *.:..*..:: . *..:. .: *::* ... *:::.***::: drosophila RHSRLYGSNMVNMVGHHNSGSSNNHNSISYPHAMECDPPQMPPPPPNGHGRMRVPAIMQL 660 immunogen HHHHHHHHHGQQALGNRTR-------------------PRVYNSPTN------------- 158 :* : : : : :*::. .::.. .: : . : ....*:: .*.*. . .: . drosophila QPNSYAPNSVPYYGNMSSSSVAAAAAAAAAAASHLMMTDSSVISASAAGGGQGGGNPGQN 720 immunogen ---------------SSSTQDSMEVGHSHHSMTSLSSSTTSSSTSSSSTGNQGNQAYQNR 203 ...: :..: . .. **:. : .. : : : * : :* ::*:: *.**. :. drosophila PVTPSAAAFLFPSQPAGTLYGTALGSLSDLPLPMPLPMSVPLQLPPSSSSSVSSGSASVG 780 immunogen PVAANTLDFGQNG-----------------------AMDVNLTVYSNPRQ---------- 230 **:..: * ...:.: .:: .: :. . . . .*.* * : ... .: ::.::: . drosophila SGGVGVGVVGQRRHITGPAAQVGISQSVGSGSSGSATGASSSDASSSSPMVGVCVQQNPV 840 immunogen ----ETGIAGHPTYQFS--ANTGPAHYMTEGHLTMRQGADREES----PMTGVCVQQSPV 280 :.. .*:.*: : ..:*:.* :: : .* **. .::::::**.******.** drosophila VIH 843 immunogen ASS 283 Unfortunately this is the only DYRK1A antibody we sell. I would recommend doing a search on our site for the other kinases in the same group, as I do not have any expertise in this area and do not know what to search for. You may also wish to use our "World's Antibody Gateway" link at the top of every search results page to look for additional antibodies that may be available through 245 other companies. I hope this information helps, please do not hesitate to contact us if you need any more advice or information.

Read More

For licensing inquiries, please contact partnerships@abcam.com

Sign up