Overview

  • Product name

    Anti-Dystonin/BPA antibody
    See all Dystonin/BPA primary antibodies
  • Description

    Rabbit polyclonal to Dystonin/BPA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Dystonin/BPA aa 2614-2703.
    Sequence:

    KPRCQNVAEDMDIQLCASILNENSDENENINTMILLDKMHSCSSLEKQQR VNVVQLASPSENNLVTEKSNLPEYTTEIAGKSKENLLNHE


    Database link: Q03001

  • Positive control

    • IHC-P: Human duodenum tissue. ICC/IF: A431 cells.
  • General notes

     This product was previously labelled as Dystonin

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab244440 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    Cytoskeletal linker protein. Acts as an integrator of intermediate filaments, actin and microtubule cytoskeleton networks. Required for anchoring either intermediate filaments to the actin cytoskeleton in neural and muscle cells or keratin-containing intermediate filaments to hemidesmosomes in epithelial cells. The proteins may self-aggregate to form filaments or a two-dimensional mesh. Isoform 3: plays a structural role in the assembly of hemidesmosomes of epithelial cells; anchors keratin-containing intermediate filaments to the inner plaque of hemidesmosomes. Required for the regulation of keratinocyte polarity and motility; mediates integrin ITGB4 regulation of RAC1 activity. Isoform 6: required for bundling actin filaments around the nucleus By similarity. Isoform 7: regulates the organization and stability of the microtubule network of sensory neurons to allow axonal transport.
  • Cellular localization

    Cytoplasm › cytoskeleton.
  • Database links

  • Alternative names

    • 230 kDa bullous pemphigoid antigen antibody
    • 230/240 kDa bullous pemphigoid antigen antibody
    • BP230 antibody
    • BP240 antibody
    • BPA antibody
    • BPAG1 antibody
    • Bullous pemphigoid antigen 1 antibody
    • Bullous pemphigoid antigen antibody
    • DMH antibody
    • DST antibody
    • DT antibody
    • Dystonia musculorum protein antibody
    • Hemidesmosomal plaque protein antibody
    • KIAA0728 antibody
    see all

Images

  • Paraffin-embedded human duodenum tissue stained for Dystonin/BPA using ab244440 at 1/50 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for Dystonin/BPA (green) using ab244440 at 4 μg/ml in ICC/IF.

References

ab244440 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244440.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up