Overview

  • Product name

    Anti-DZANK1 antibody
  • Description

    Rabbit polyclonal to DZANK1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human DZANK1 aa 183-271.
    Sequence:

    PGFAHVSGQKCLTSTEIMRIQRETDFLKCAHCLAPRPSDPFARFCQECGS PVPPIFGCRLPPPEGAQMGLCAECRSLVPMNTPICVVCE


    Database link: Q9NVP4

  • Positive control

    • WB: RT-4, U-251 MG cell lysate; human plasma, liver and tonsil lysates. ICC/IF: CACO-2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab221461 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

WB 1/250 - 1/500. Predicted molecular weight: 82 kDa.

Target

Images

  • All lanes : Anti-Syntaxin 7 antibody [CL0257] (ab211461) at 1/250 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma lysate
    Lane 4 : Human liver lysate
    Lane 5 : Human tonsil lysate

    Predicted band size: 82 kDa

  • Immunofluorescent analysis of paraformaldehyde-fixed, Triton X-100 permeabilized CACO-2 cells labeling DZANK1 with ab221461 at 4 μg/mL dilution (green). 

References

ab221461 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221461.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up