Anti-DZIP1L antibody (ab201199)
Key features and details
- Rabbit polyclonal to DZIP1L
- Suitable for: IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-DZIP1L antibody -
Description
Rabbit polyclonal to DZIP1L -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human DZIP1L aa 58-284. (BC033308).
Sequence:NIAGITFCNLDREVCSRCGQPVDPALLKVLRLAQLIIEYLLHCQDCLSAS VAQLEARLQTSLGQQQRGQQELGRQADELKGVREESRRRRKMISTLQQLL MQTGTHSYHTCHLCDKTFMNATFLRGHIQRRHAGVAEGGKQKKQEQPVEE VLEELRAKLKWTQGELEAQREAERQRQLQEAELIHQREIEAKKEFDKWKE QEWTKLYGEIDKLKKLFWDEFKNVAKQ
Database link: Q8IYY4 -
Positive control
- 293 and 293T cell lysates; Human pancreas carcinoma tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Lyophilized:Reconstitute in 200ul sterile H2O. -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 98% PBS, 1% BSA -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab201199 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/100 - 1/500. | |
WB | 1/200 - 1/1000. Predicted molecular weight: 87 kDa. |
Target
-
Sequence similarities
Belongs to the DZIP C2H2-type zinc-finger protein family.
Contains 1 C2H2-type zinc finger. - Information by UniProt
-
Database links
- Entrez Gene: 199221 Human
- Entrez Gene: 72507 Mouse
- Entrez Gene: 315952 Rat
- SwissProt: Q8IYY4 Human
- SwissProt: Q499E4 Mouse
- SwissProt: Q5XIA0 Rat
- Unigene: 351403 Human
-
Alternative names
- DAZ interacting protein 1 like antibody
- DAZ interacting zinc finger protein 1 like antibody
- DAZ-interacting protein 1-like protein antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DZIP1L antibody (ab201199)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human pancreas carcinoma tissue labeling DZIP1L with ab201199 at 1/100 dilution.
-
All lanes : Anti-DZIP1L antibody (ab201199) at 1/500 dilution
Lane 1 : 293 cell l ysate
Lane 2 : 293T cell lysate
Predicted band size: 87 kDa
Protocols
References (0)
ab201199 has not yet been referenced specifically in any publications.