Overview

  • Product name

  • Description

    Rabbit polyclonal to E2F2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human E2F2 aa 1-83.
    Sequence:

    MLQGPRALASAAGQTPKVVPAMSPTELWPSGLSSPQLCPATATYYTPLYP QTAPPAAAPGTCLDATPHGPEGQVVRCLPAGRL


    Database link: Q14209

  • Positive control

    • WB: HEK-293T whole cell lysate. IHC-P: Human kidney, brain and placenta tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab235837 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 48 kDa.

Target

  • Function

    Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from g1 to s phase. E2F-2 binds specifically to RB1 protein, in a cell-cycle dependent manner.
  • Tissue specificity

    Highest level of expression is found in placenta, low levels are found in lung. Found as well in many immortalized cell lines derived from tumor samples.
  • Sequence similarities

    Belongs to the E2F/DP family.
  • Post-translational
    modifications

    Phosphorylated by CDK2 and cyclin A-CDK2 in the S-phase.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • dE2F2 antibody
    • E2F transcription factor 2 antibody
    • E2F-2 antibody
    • E2F2 antibody
    • E2F2_HUMAN antibody
    • Transcription factor E2F2 antibody
    see all

Images

  • Anti-E2F2 antibody (ab235837) at 1/500 dilution + HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Secondary
    Goat polyclonal to rabbit at 1/10000 dilution

    Predicted band size: 48 kDa

  • Paraffin-embedded human kidney tissue stained for E2F2 using ab235837 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human brain tissue stained for E2F2 using ab235837 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human placenta tissue stained for E2F2 using ab235837 at 1/100 dilution in immunohistochemical analysis.

References

ab235837 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235837.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up