Overview

  • Product name

  • Description

    Rabbit polyclonal to E2F5
  • Host species

    Rabbit
  • Specificity

    ab22855 recognises Transcription factor E2F5.
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken
  • Immunogen

    Synthetic peptide corresponding to Human E2F5 aa 134-183.
    Sequence:

    KAEIEDLELKERELDQQKLLLQQSIKNVMDDSINNRFSYVTHEDICNCFN

  • Positive control

    • Jurkat cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab22855 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.4 µg/ml. Detects a band of approximately 34 kDa (predicted molecular weight: 38 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Images

  • Anti-E2F5 antibody (ab22855) at 0.4 µg/ml + Jurkat cell lysate with 5% skim milk in PBS

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 38 kDa
    Observed band size: 32 kDa
    why is the actual band size different from the predicted?

References

ab22855 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab22855.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up