Overview

  • Product name

    Anti-E3 ubiquitin-protein ligase MUL1 antibody [ABM4F71] - C-terminal
    See all E3 ubiquitin-protein ligase MUL1 primary antibodies
  • Description

    Mouse monoclonal [ABM4F71] to E3 ubiquitin-protein ligase MUL1 - C-terminal
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human E3 ubiquitin-protein ligase MUL1 aa 146-352 (C terminal).
    Sequence:

    DSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPKGIQETEEMLKVGATL TGVGELVLDNNSVRLQPPKQGMQYYLSSQDFDSLLQRQESSVRLWKVLAL VFGFATCATLFFILRKQYLQRQERLRLKQMQEEFQEHEAQLLSRAKPEDR ESLKSACVVCLSSFKSCVFLECGHVCSCTECYRALPEPKKCPICRQAITR VIPLYNS


    Database link: Q969V5

  • Positive control

    • Human skeletal muscle lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab210929 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 4 µg/ml. Predicted molecular weight: 40 kDa.

Target

  • Function

    Exhibits weak E3 ubiquitin-protein ligase activity, but preferentially acts as a SUMO E3 ligase at physiological concentrations. Plays a role in the control of mitochondrial morphology. Promotes mitochondrial fragmentation and influences mitochondrial localization. Inhibits cell growth. When overexpressed, activates JNK through MAP3K7/TAK1 and induces caspase-dependent apoptosis. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
  • Tissue specificity

    Widely expressed with highest levels in the heart, skeletal muscle, placenta, kidney and liver. Barely detectable in colon and thymus.
  • Pathway

    Protein modification; protein ubiquitination.
    Protein modification; protein sumoylation.
  • Sequence similarities

    Contains 1 RING-type zinc finger.
  • Domain

    The zinc finger domain is required for E3 ligase activity.
  • Cellular localization

    Mitochondrion outer membrane. Peroxisome. Transported in mitochondrion-derived vesicles from the mitochondrion to the peroxisome.
  • Information by UniProt
  • Database links

  • Alternative names

    • 0610009K11Rik antibody
    • AV000801 antibody
    • C1orf166 antibody
    • Chromosome 1 open reading frame 166 antibody
    • E3 SUMO-protein ligase MUL1 antibody
    • E3 ubiquitin ligase antibody
    • E3 ubiquitin protein ligase MUL1 antibody
    • E3 ubiquitin-protein ligase MUL1 antibody
    • FLJ12875 antibody
    • GIDE antibody
    • Growth inhibition and death E3 ligase antibody
    • MAPL antibody
    • Mitochondrial anchored protein ligase antibody
    • mitochondrial E3 ubiquitin ligase 1 antibody
    • mitochondrial E3 ubiquitin protein ligase 1 antibody
    • Mitochondrial ubiquitin ligase activator of NFKB 1 antibody
    • Mitochondrial-anchored protein ligase antibody
    • MUL1 antibody
    • MUL1_HUMAN antibody
    • MULAN antibody
    • Putative NF kappa B activating protein 266 antibody
    • Putative NF-kappa-B-activating protein 266 antibody
    • RGD1309944 antibody
    • RING finger protein 218 antibody
    • RNF218 antibody
    • RP11-401M16.2 antibody
    • RP23-25C1.10-002 antibody
    see all

Images

  • Anti-E3 ubiquitin-protein ligase MUL1 antibody [ABM4F71] - C-terminal (ab210929) at 4 µg/ml + Human skeletal muscle lysate

    Predicted band size: 40 kDa

References

ab210929 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab210929.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up