Anti-EAAT2 antibody (ab203130)

Rabbit polyclonal EAAT2 antibody. Validated in WB, IHC and tested in Mouse, Rat, Human. Immunogen corresponding to synthetic peptide.

Overview

  • Product name

  • Description

    Rabbit polyclonal to EAAT2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human EAAT2 aa 143-190 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    HPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQT


    Database link: P43004

  • Positive control

    • Rat brain tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 0.01% BSA, 50% Glycerol

    Aqueous buffered solution.
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab203130 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 62 kDa.
IHC-P 1/100 - 1/500.

(or 1/50 - 1/200 using a fluorescent secondary antibody).

Target

  • Function

    Transports L-glutamate and also L- and D-aspartate. Essential for terminating the postsynaptic action of glutamate by rapidly removing released glutamate from the synaptic cleft. Acts as a symport by cotransporting sodium.
  • Sequence similarities

    Belongs to the sodium:dicarboxylate (SDF) symporter (TC 2.A.23) family. SLC1A2 subfamily.
  • Post-translational
    modifications

    Glycosylated.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • EAA2_HUMAN antibody
    • EAAT2 antibody
    • Excitatory amino acid transporter 2 antibody
    • Excitotoxic amino acid transporter 2 antibody
    • Glial high affinity glutamate transporter antibody
    • GLT 1 antibody
    • GLT1 antibody
    • Glutamate aspartate transporter II antibody
    • Glutamate transporter 1 antibody
    • Glutamate/aspartate transporter II antibody
    • Slc1a2 antibody
    • Sodium dependent glutamate aspartate transporter 2 antibody
    • Sodium-dependent glutamate/aspartate transporter 2 antibody
    • solute carrier family 1 (glial high affinity glutamate transporter), member 2 antibody
    • Solute carrier family 1 glial high affinity glutamate transporter member 2 antibody
    • Solute carrier family 1 member 2 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Rat brain tissue labeling EAAT2 with ab203130 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

This product has been referenced in:

  • Yang Z  et al. Inhibition of p38 MAPK Signaling Regulates the Expression of EAAT2 in the Brains of Epileptic Rats. Front Neurol 9:925 (2018). Read more (PubMed: 30429824) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203130.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up