Overview

  • Product name

  • Description

    Rabbit polyclonal to EAAT5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human EAAT5 aa 115-220.
    Sequence:

    HPGSAAQKETTEQSGKPIMSSADALLDLIRNMFPANLVEATFKQYRTKTT PVVKSPKVAPEEAPPRRILIYGVQEENGSHVQNFALDLTPPPEVVYKSEP GTSDGM


    Database link: O00341

  • Positive control

    • IHC-P: Human kidney tissue. ICC/IF: HepG2 cells.
  • General notes

     This product was previously labelled as SLC1A7

     

Properties

Applications

Our Abpromise guarantee covers the use of ab230207 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    Transports L-glutamate; the L-glutamate uptake is sodium- and voltage-dependent and chloride-independent. Its associated chloride conductance may participate in visual processing.
  • Tissue specificity

    Expressed primarily in retina. Detectable in liver, heart, muscle and brain.
  • Sequence similarities

    Belongs to the dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family. SLC1A7 subfamily.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AAAT antibody
    • EAA5_HUMAN antibody
    • EAAT5 antibody
    • Excitatory amino acid transporter 5 (retinal glutamate transporter) antibody
    • Excitatory amino acid transporter 5 antibody
    • FLJ36602 antibody
    • Retinal glutamate transporter antibody
    • Slc1a7 antibody
    • Solute carrier family 1 (glutamate transporter) member 7 antibody
    • Solute carrier family 1 member 7 antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for EAAT5 using ab230207 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for EAAT5 (green) using ab230207 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® congugated Goat Anti-Rabbit IgG (H+L).

References

ab230207 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230207.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up