Anti-EAAT5 antibody (ab230217)
Key features and details
- Rabbit polyclonal to EAAT5
- Suitable for: ICC/IF, IHC-P, WB
- Reacts with: Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-EAAT5 antibody
See all EAAT5 primary antibodies -
Description
Rabbit polyclonal to EAAT5 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-P, WBmore details -
Species reactivity
Reacts with: Rat, Human -
Immunogen
Recombinant fragment corresponding to Human EAAT5 aa 115-220.
Sequence:HPGSAAQKETTEQSGKPIMSSADALLDLIRNMFPANLVEATFKQYRTKTT PVVKSPKVAPEEAPPRRILIYGVQEENGSHVQNFALDLTPPPEVVYKSEP GTSDGM
Database link: O00341 -
Positive control
- WB: Rat heart tissue lysate. IHC-P: Human kidney tissue. ICC/IF: HepG2 cells.
-
General notes
This product was previously labelled as SLC1A7
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab230217 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | 1/50 - 1/200. | |
IHC-P | 1/20 - 1/200. | |
WB | 1/1000 - 1/5000. Detects a band of approximately 61 kDa (predicted molecular weight: 61,17 kDa). |
Target
-
Function
Transports L-glutamate; the L-glutamate uptake is sodium- and voltage-dependent and chloride-independent. Its associated chloride conductance may participate in visual processing. -
Tissue specificity
Expressed primarily in retina. Detectable in liver, heart, muscle and brain. -
Sequence similarities
Belongs to the dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family. SLC1A7 subfamily. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 6512 Human
- Entrez Gene: 366432 Rat
- Omim: 604471 Human
- SwissProt: O00341 Human
- Unigene: 104637 Human
-
Alternative names
- AAAT antibody
- EAA5_HUMAN antibody
- EAAT5 antibody
see all
Images
-
Anti-EAAT5 antibody (ab230217) at 1/500 dilution + Rat heart tissue lysate
Secondary
Goat anti-rabbit IgG at 1/10000 dilution
Developed using the ECL technique.
Predicted band size: 61,17 kDa
Observed band size: 61 kDa why is the actual band size different from the predicted? -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-EAAT5 antibody (ab230217)
Paraffin-embedded human kidney tissue stained for EAAT5 using ab230217 at 1/100 dilution in immunohistochemical analysis.
-
HepG2 (human liver hepatocellular carcinoma cell line) cells stained for EAAT5 using ab230217 at 1/100 dilution in ICC/IF. Secondary used is an Alexa Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab230217 has not yet been referenced specifically in any publications.