Overview

  • Product name

  • Description

    Rabbit polyclonal to EAG1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human EAG1 aa 840-989.
    Sequence:

    FKDACGKSEDWNKVSKAESMETLPERTKASGEATLKKTDSCDSGITKSDL RLDNVGEARSPQDRSPILAEVKHSFYPIPEQTLQATVLEVRHELKEDIKA LNAKMTNIEKQLSEILRILTSRRSSQSPQELFEISRPQSPESERDIFGAS


    Database link: O95259-1

  • Positive control

    • IHC-P: Human brain tissue.
  • General notes

    Previously labelled as KCNH1.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab223798 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Pore-forming (alpha) subunit of voltage-gated non-inactivating delayed rectifier potassium channel. Channel properties may be modulated by cAMP and subunit assembly. Mediates IK(NI) current in myoblasts.
  • Tissue specificity

    Highly expressed in brain and in myoblasts at the onset of fusion, but not in other tissues. Detected in HeLa (cervical carcinoma), SH-SY5Y (neuroblastoma) and MCF-7 (epithelial tumor) cells, but not in normal epithelial cells.
  • Sequence similarities

    Belongs to the potassium channel family. H (Eag) (TC 1.A.1.20) subfamily. Kv10.1/KCNH1 sub-subfamily.
    Contains 1 cyclic nucleotide-binding domain.
    Contains 1 PAC (PAS-associated C-terminal) domain.
    Contains 1 PAS (PER-ARNT-SIM) domain.
  • Domain

    The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • EAG antibody
    • EAG channel 1 antibody
    • EAG1 antibody
    • Ether a go go potassium channel 1 antibody
    • Ether a go go, Drosophila, homolog of antibody
    • Ether-a-go-go potassium channel 1 antibody
    • ether-a-go-go, Drosophila, homolog of antibody
    • h eag antibody
    • h-eag antibody
    • hEAG1 antibody
    • Kcnh1 antibody
    • KCNH1_HUMAN antibody
    • Kv10.1 antibody
    • M eag antibody
    • MGC124419 antibody
    • MGC124420 antibody
    • MGC142269 antibody
    • Potassium voltage gated channel subfamily H (eag related), member 1 antibody
    • Potassium voltage gated channel subfamily H member 1 antibody
    • Potassium voltage-gated channel subfamily H member 1 antibody
    • Voltage gated potassium channel subunit Kv10.1 antibody
    • Voltage-gated potassium channel subunit Kv10.1 antibody
    see all

Images

  • Paraffin-embedded human brain tissue stained for EAG1 with ab223798 at 1/100 dilution in immunohistochemical analysis.

References

ab223798 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223798.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up