Overview

  • Product name

  • Description

    Rabbit polyclonal to EAG2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human EAG2 aa 371-417.
    Sequence:

    GDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDS


    Database link: Q8NCM2

  • Positive control

    • IHC-P: Human skeletal muscle tissue.
  • General notes

    Previously labelled as KCNH5. 

Properties

Applications

Our Abpromise guarantee covers the use of ab224482 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. The EAG2 gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit of a voltage-gated non-inactivating delayed rectifier potassium channel. EAG2 is not expressed in differentiating myoblasts.
  • Cellular localization

    Cell Membrane: multi-pass membrane protein.
  • Database links

  • Alternative names

    • EAG2 antibody
    • Ether a go go potassium channel 2 antibody
    • H EAG2 antibody
    • HGNC:6254 antibody
    • KCNH5 antibody
    • Kv10.2 antibody
    • potassium voltage gated channel subfamily H (eag-related) member 5 antibody
    • Voltage gated potassium channel subunit Kv10.2 antibody
    see all

Images

  • Paraffin-embedded human skeletal muscle tissue stained for EAG2 using ab224482 at 1/50 dilution in immunohistochemical analysis.

References

ab224482 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224482.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up