Overview

  • Product name
  • Description
    Rabbit polyclonal to EAG2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ELISA, WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide within Human EAG2 aa 156-205 (N terminal). The exact sequence is proprietary.
    Sequence:

    LTNSRSVLQQLTPMNKTEVVHKHSRLAEVLQLGSDILPQYKQEAPKTPPH


    Database link: Q8NCM2

  • Positive control
    • HepG2 cell lysate and human brain tissue.
  • General notes

    Previously labelled as KCNH5. 

Properties

Applications

Our Abpromise guarantee covers the use of ab32975 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA 1/312500.
WB Use a concentration of 0.5 µg/ml. Detects a band of approximately 60 kDa (predicted molecular weight: 112 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use at an assay dependent concentration.

Target

  • Relevance
    Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. The EAG2 gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit of a voltage-gated non-inactivating delayed rectifier potassium channel. EAG2 is not expressed in differentiating myoblasts.
  • Cellular localization
    Cell Membrane: multi-pass membrane protein.
  • Database links
  • Alternative names
    • EAG2 antibody
    • Ether a go go potassium channel 2 antibody
    • H EAG2 antibody
    • HGNC:6254 antibody
    • KCNH5 antibody
    • Kv10.2 antibody
    • potassium voltage gated channel subfamily H (eag-related) member 5 antibody
    • Voltage gated potassium channel subunit Kv10.2 antibody
    see all

Images

  • Anti-EAG2 antibody (ab32975) at 0.5 µg/ml + HepG2 cell lysate

    Secondary
    HRP-conjugated anti-rabbit IgG at 1/50000 dilution

    Predicted band size: 112 kDa
    Observed band size: 60 kDa
    why is the actual band size different from the predicted?

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human brain tissue labelling EAG2 at 4-8µg/ml. Neural cells with positive label are indicated by arrows.

References

This product has been referenced in:
  • Huang X  et al. Voltage-gated potassium channel EAG2 controls mitotic entry and tumor growth in medulloblastoma via regulating cell volume dynamics. Genes Dev 26:1780-96 (2012). Read more (PubMed: 22855790) »
  • Macaulay EC  et al. Hypomethylation of functional retrotransposon-derived genes in the human placenta. Mamm Genome 22:722-35 (2011). IHC-P ; Human . Read more (PubMed: 21874386) »
See all 2 Publications for this product

Customer reviews and Q&As

Answer

Vielen Dank für diese Rückmeldung. Es tut mir wirklich sehr leid, dass Sie keine zufriedenstellenden Ergebnisse erhalten haben! Zu den KCNH5-Antikörpern: Es ist in der Tat sehr einfach, in den 'Additional Notes' eine kurze Notiz zu den erzielten Ergebnissen zu machen – die Box finden Sie ganz unten im Onlineformular. Es tut mir leid, dass die beiden Antikörper nicht spezifisch für KCNH5 zu sein scheinen, sondern offenbar auch KCNH1 detektieren. Ich habe die Immunogensequenzen geblastet, und zumindest die für ab32975 zeigt eine Ähnlichkeit von 84% gegen KCNH1, so dass eine Kreuzreaktivität in der Tat nicht ausgeschlossen werden kann. Allerdings überrascht es mich, dass ab86216 mit einer Sequenzähnlichkeit von nur 34% gegen KCNH1 auch ein Signal ergibt. Welche Negativkontrolle hatten Sie denn mitgeführt? Ich bin wirklich gespannt, Ihre Abreviews in den HEK-Zellen zu sehen! (Dafür werden Sie auf jeden Fall eine Menge Abpoints erhalten, sobald unser Abreviewteam die Abreviews angesehen hat!) Hatten Sie die beiden Antikörper denn auch mit Mausproben getestet? Dafür hatte ich Ihnen ja die Rabattcodes ausgestellt. Denn wenn Sie zusaetzlich noch Abreviews über den Test in Maus einreichen, erhalten Sie nicht nur die normalen Abpoints, sondern auch jeweils den kostenlosen Antikörper aus dem Rabattprogramm. Zu den KCNH1-Antikörpern: Es tut mir leid zu hören, dass keiner der vier Antikörper für Sie geeignet scheint! Natürlich werden Sie die kostenlosen Antikörper aus dem Testprogramm erhalten, sobald wir Ihre Abreviews angeschaut haben und es sich herausstellt, dass sie nicht für die Maus (bzw. die IHC) geeignet sind. Um die Rabattcode freizuschalten, wird unser Abreviewteam sicherlich noch einige Informationen erfragen, und um Ihnen die doppelte Mühe zu ersparen, möchte ich dies gerne schon einmal mit Ihnen klären: 1) Darf ich fragen, wie die Antikörper in Westernblots für humane Proben (zum Beispiel die KCNH1-HEK-Zellen) bzw. in einer Positivkontrolle (zum Beispiel wt-Maus) aussehen? Gerade für ab101174 wäre dies die Kontrolle, die zeigt, dass der Antikörper wie auf dem Datenblatt angegeben (d.h. gegen human, im Western blot) und zusätzlich für die Maus im Westernblot funktioniert, dass er aber nicht in der IHC geeignet ist. Hierzu wäre es hilfreich, wenn Sie mir ein paar Bilder zusenden könnten, vielleicht am besten diejenigen, die Sie auch mit den Abreviews einreichen würden? 2) Gegen welchen Teil von KCNH1 ist Ihr eigener, nicht kommerzieller Antikörper denn gerichtet? Ist er vergleichbar zu einem der vier getesteten, d.h. zum Beispiel gegen den C-Terminus? Dies wäre wichtig, um auszuschließen, dass bei der knockout-Maus auch ein vollständiger knockout vorliegt und kein Fragment von KCNH1 exprimiert wird. Hatten Sie dies auch durch Southernblot oder PCR verifiziert? Ich möchte Ihnen gerne versichern, dass Sie für all Ihre Mühen natürlich entlohnt werden: Für die entsprechenden Abreviews bekommen Sie nicht nur die kostenlosen Antikörper, sondern auch zusätzlich noch die Abpoints (ebenso wie für jeden zusätzlich eingereichten Abreview). Des Weiteren hoffe ich, dass wir für Ihre Versuchsvorhaben geeignete Antikörper finden! Falls sich herausstellt, dass die Antikörper nicht so funktionieren, wie auf dem Datenblatt beschrieben, werden wir Ihnen gerne einen Ersatz oder eine Gutschrift schicken. Ich freue mich auf Ihre Antworten!

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up