Overview

  • Product name

  • Description

    Rabbit polyclonal to EARS2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human EARS2 aa 42-166.
    Sequence:

    APSPTGFLHLGGLRTALYNYIFAKKYQGSFILRLEDTDQTRVVPGAAENI EDMLEWAGIPPDESPRRGGPAGPYQQSQRLELYAQATEALLKTGAAYPCF CSPQRLELLKKEALRNHQTPRYDNR


    Database link: Q5JPH6

  • Positive control

    • IHC-P: Human ovarian cancer tissue and adrenal gland tissues.
  • General notes

    Previously labelled as KIAA1970. 

Properties

Applications

Our Abpromise guarantee covers the use of ab225913 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Catalyzes the attachment of glutamate to tRNA(Glu) in a two-step reaction: glutamate is first activated by ATP to form Glu-AMP and then transferred to the acceptor end of tRNA(Glu).
  • Sequence similarities

    Belongs to the class-I aminoacyl-tRNA synthetase family.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • 3230401I01Rik antibody
    • AL024049 antibody
    • COXPD12 antibody
    • EARS 2 antibody
    • ears2 antibody
    • GluRS antibody
    • Glutamate--tRNA ligase antibody
    • Glutamyl tRNA synthetase 2 mitochondrial antibody
    • KIAA1970 antibody
    • mitochondrial antibody
    • mKIAA1970 antibody
    • MSE1 antibody
    • Probable glutamyl tRNA synthetase, mitochondrial antibody
    • Probable glutamyl-tRNA synthetase antibody
    • RGD1307904 antibody
    • SYEM_HUMAN antibody
    see all

Images

  • Paraffin-embedded human ovarian carcinoma tissue stained for EARS2 using ab225913 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human adrenal gland tissue stained for EARS2 using ab225913 at 1/100 dilution in immunohistochemical analysis.

References

ab225913 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225913.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up