Overview

  • Product name

  • Description

    Rabbit polyclonal to EBS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human EBS aa 174-206.
    Sequence:

    TLRLTVSESEHQWLLEQTSHVEEKPYRDGSAEP


    Database link: Q9BTE0

  • Positive control

    • U-2 OS cells.
  • General notes

     This product was previously labelled as NAT9

     

Properties

Applications

Our Abpromise guarantee covers the use of ab220876 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Sequence similarities

    Belongs to the acetyltransferase family. GNAT subfamily.
    Contains 1 N-acetyltransferase domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • EBSP antibody
    • Embryo brain specific protein antibody
    • Embryo brain-specific protein antibody
    • hNATL antibody
    • N-acetyltransferase 9 antibody
    • Nacetyltransferase 9 antibody
    • Nat9 antibody
    • NAT9_HUMAN antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2 OS cells labeling EBS with ab220876 at 4 µg/ml (green).

References

ab220876 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220876.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up