Overview

  • Product name

    Anti-EBS antibody - N-terminal
    See all EBS primary antibodies
  • Description

    Rabbit polyclonal to EBS - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human EBS aa 1-67 (N terminal).
    Sequence:

    MRLNQNTLLLGKKVVLVPYTSEHVPRYHEWMKSEELQRLTASEPLTLEQE YAMQCSWQEDADKCTFI


    Database link: Q9BTE0-2

  • Positive control

    • IHC-P: Human spleen tissue.
  • General notes

     This product was previously labelled as NAT9

     

Properties

Applications

Our Abpromise guarantee covers the use of ab224439 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Sequence similarities

    Belongs to the acetyltransferase family. GNAT subfamily.
    Contains 1 N-acetyltransferase domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • EBSP antibody
    • Embryo brain specific protein antibody
    • Embryo brain-specific protein antibody
    • hNATL antibody
    • N-acetyltransferase 9 antibody
    • Nacetyltransferase 9 antibody
    • Nat9 antibody
    • NAT9_HUMAN antibody
    see all

Images

  • Paraffin-embedded human spleen tissue stained for EBS using ab224439 at 1/20 dilution in immunohistochemical analysis.

References

ab224439 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224439.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up