Anti-ECEL1 antibody (ab234710)
Key features and details
- Rabbit polyclonal to ECEL1
- Suitable for: ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-ECEL1 antibody
See all ECEL1 primary antibodies -
Description
Rabbit polyclonal to ECEL1 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human ECEL1 aa 425-775.
Sequence:AQEMEGSDKPQELARVCLGQANRHFGMALGALFVHEHFSAASKAKVQQLV EDIKYILGQRLEELDWMDAETRAAARAKLQYMMVMVGYPDFLLKPDAVDK EYEFEVHEKTYFKNILNSIRFSIQLSVKKIRQEVDKSTWLLPPQALNAYY LPNKNQMVFPAGILQPTLYDPDFPQSLNYGGIGTIIGHELTHGYDDWGGQ YDRSGNLLHWWTEASYSRFLRKAECIVRLYDNFTVYNQRVNGKHTLGENI ADMGGLKLAYHAYQKWVREHGPEHPLPRLKYTHDQLFFIAFAQNWCIKRR SQSIYLQVLTDKHAPEHYRVLGSVSQFEEFGRAFHCPKDSPMNPAHKCSV W
Database link: O95672 -
Positive control
- IHC-P: Human kidney and cervical cancer tissue. ICC/IF: HepG2 and HeLa cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: PBS, 50% Glycerol (glycerin, glycerine), 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab234710 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | 1/50 - 1/200. | |
IHC-P | 1/20 - 1/200. |
Target
-
Function
May contribute to the degradation of peptide hormones and be involved in the inactivation of neuronal peptides. -
Tissue specificity
Highly expressed in the CNS, in particular in putamen, spinal cord, medulla and subthalamic nucleus. A strong signal was also detected in uterine subepithelial cells and around renal blood vessels. Detected at lower levels in amygdala, caudate, thalamus, pancreas and skeletal muscle. Detected at very low levels in substantia nigra, cerebellum, cortex, corpus callosum and hippocampus. -
Sequence similarities
Belongs to the peptidase M13 family. -
Post-translational
modificationsN-glycosylated. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 9427 Human
- SwissProt: O95672 Human
- Unigene: 26880 Human
-
Alternative names
- Ecel1 antibody
- ECEL1_HUMAN antibody
- Endothelin-converting enzyme-like 1 antibody
- Xce protein antibody
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ECEL1 antibody (ab234710)
Paraffin-embedded human kidney tissue stained for ECEL1 using ab234710 at 1/100 dilution in immunohistochemical analysis.
-
HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for ECEL1 (green) using ab234710 at 1/100 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ECEL1 antibody (ab234710)
Paraffin-embedded human cervical cancer tissue stained for ECEL1 using ab234710 at 1/100 dilution in immunohistochemical analysis.
-
HepG2 (human liver hepatocellular carcinoma cell line) cells stained for ECEL1 (green) using ab234710 at 1/100 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab234710 has not yet been referenced specifically in any publications.