Overview

  • Product name

  • Description

    Rabbit polyclonal to ECHDC2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ECHDC2 aa 189-258.
    Sequence:

    LIFTGRRLSGTEAHVLGLVNHAVAQNEEGDAAYQRARALAQEILPQAPIA VRLGKVAIDRGTEVDIASGM


    Database link: Q86YB7

  • Positive control

    • IHC-P: Human liver tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224470 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    ECHDC2 belongs to the enoyl-CoA hydratase/isomerase family. There are two named isforms.
  • Cellular localization

    Mitochondrion
  • Database links

  • Alternative names

    • 1300017C12Rik antibody
    • 2610009M20Rik antibody
    • D4Ertd765e antibody
    • Enoyl Coenzyme A hydratase domain containing 2 antibody
    • FLJ10948 antibody
    • RGD1308525 antibody
    • RP23-379K6.3 antibody
    see all

Images

  • Paraffin embedded human liver tissue stained for ECHDC2 with ab224470 (1/50 dilution) in immunohistochemical analysis.

References

ab224470 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224470.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up