Overview

  • Product name

  • Description

    Mouse polyclonal to EDA2R/XEDAR
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rabbit, Chimpanzee, Macaque monkey, Gorilla, Common marmoset, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human EDA2R/XEDAR aa 1-297.
    Sequence:

    MDCQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYK SSWGHHRCQSCITCAVINRVQKVNCTATSNAVCGDCLPRFYRKTRIGGLQ DQECIPCTKQTPTSEVQCAFQLSLVEADAPTVPPQEATLVALVSSLLVVF TLAFLGLFFLYCKQFFNRHCQRGGLLQFEADKTAKEESLFPVPPSKETSA ESQVSENIFQTQPLNPILEDDCSSTSGFPTQESFTMASCTSESHSHWVHS PIECTELDLQKFSSSASYTGAETLGGNTVESTGDRLELNVPFEVPSP


    Database link: NP_068555.1

  • Positive control

    • EDA2R/XEDAR transfected 293T cells.
  • General notes

     This product was previously labelled as EDA2R

     

Properties

Applications

Our Abpromise guarantee covers the use of ab167224 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 33 kDa.
Flow Cyt Use at an assay dependent concentration.

ab37355 - Mouse polyclonal IgG, is suitable for use as an isotype control with this antibody.

 

Target

  • Function

    Receptor for EDA isoform A2, but not for EDA isoform A1. Mediates the activation of the NF-kappa-B and JNK pathways. Activation seems to be mediated by binding to TRAF3 and TRAF6.
  • Sequence similarities

    Contains 3 TNFR-Cys repeats.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 9430060M22Rik antibody
    • Ectodysplasin A2 isoform receptor antibody
    • Ectodysplasin A2 receptor antibody
    • EDA A2R antibody
    • EDA-A2 receptor antibody
    • EDA2R antibody
    • EDAA2R antibody
    • MGC124099 antibody
    • OTTMUSP00000019574 antibody
    • OTTMUSP00000019575 antibody
    • RP23-188N15.1 antibody
    • TNFRSF27 antibody
    • TNR27_HUMAN antibody
    • Tumor necrosis factor receptor superfamily member 27 antibody
    • Tumor necrosis factor receptor superfamily member XEDAR antibody
    • X linked ectodysplasin A2 receptor antibody
    • X linked ectodysplasin receptor antibody
    • X-linked ectodysplasin-A2 receptor antibody
    • XEDAR antibody
    see all

Images

  • All lanes : Anti-EDA2R/XEDAR antibody (ab167224) at 1 µg/ml

    Lane 1 : EDA2R/XEDAR Transfected 293T cell lysate at 15 µg
    Lane 2 : Non transfected 293T cell lysate at 15 µl

    Predicted band size: 33 kDa

References

ab167224 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167224.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up